Recombinant Mouse C-X-C Chemokine Receptor Type 3 (CXCR3) Protein (His-KSI)

Name: Recombinant Mouse C-X-C Chemokine Receptor Type 3 (CXCR3) Protein (His-KSI)
Brand: Beta LifeScience
SKU: BLC-04852P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse C-X-C Chemokine Receptor Type 3 (CXCR3) Protein (His-KSI) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O88410
Target Symbol	CXCR3
Synonyms	Cxcr3; Cmkar3; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His-KSI
Target Protein Sequence	MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR
Expression Range	1-52aa
Protein Length	Partial
Mol. Weight	21.3 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response. Binds to CCL21.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	KEGG: mmu:12766 STRING: 10090.ENSMUSP00000052444 UniGene: PMID: 28358049 the data suggest that CXCR3 and the integrin alpha4 mediate T cell recruitment to uninfected salivary glands but that redundant mechanisms mediate T cell recruitment after Murine Cytomegalovirus infection. PMID: 29288198 The data of this study suggested that spinal CXCR3 mediates chronic itch and alloknesis, and targeting CXCR3 may provide effective treatment for chronic pruritus. PMID: 28401489 Study provided the evidence that CXCL10/CXCR3 signaling in periaqueductal gray is involved in the development of morphine analgesic tolerance via neuron-microglia interaction. PMID: 28755808 The results demonstrate that the recruitment of peripheral immune cells into the CNS, induction of neuroinflammation, and consecutive weight loss during herpes encephalitis is modulated by CXCR3 signaling. PMID: 28116674 results show an important role for CXCR3 and CXCL10 in the tissue distribution of preimmune memory phenotype CD8 T- cells PMID: 29187588 Our data suggests that the altered gene profiles induced by CXCR3 deficiency promotes autoimmune cholangitis through pathogenic CD8(+) T cells. PMID: 28129932 Data suggest that the CXCL9-CXCR3 axis plays a pivotal role in the liver-specific distribution of TRAIL+ NK cells in mice. PMID: 29088306 study thus shows that lung mucosal-resident memory T cells are not generated following systemic TB immunization and that local inflammation is required for systemically activated T cells to home to lung mucosa, which is mediated by interaction between CXCR3 upregulated in these cells and its ligands IP-10 and MIG PMID: 28827285 Antigen targeting to DEC-205 on dendritic cells leads to an IL-10-dependent downregulation of CXCR3 expression on differentiated antigen-specific Th1 cells in vivo. This downregulation interferes with the migration of Th1 cells into the gut and protects mice against severe acute and relapsing intestinal inflammation. PMID: 26732675 this study shows that neutrophils and NK cells act as important disease-promoting immune cells in experimental osteoarthritis and their functional interaction is promoted by the CXCL10/CXCR3 axis PMID: 28108560 These results demonstrate a critical role for both BLT1 and CXCR3 in cytotoxic T lymphocyte (CTL) migration to tumors and thus may be targeted to enhance efficacy of CTL-based immunotherapies. PMID: 27465528 Our studies suggest that CXCR3 is a key contributor to the pathogenesis of Alopecia areata by mediating the infiltration of autoreactive CD8+NKG2D+ T cells into the skin PMID: 27412416 Cxcr3 is up-regulated by DNA demethylation and interaction with C/EBPalpha which contributes to neuropathic pain. PMID: 28100749 These findings demonstrate that the CXCL10/CXCR3 chemokine pathway is critical in shaping CD8(+) T cell immunity, locally within latently infected tissues, which protects against recurrent herpesvirus infection and disease. PMID: 28468883 this study shows that although T cell-specific expression of CXCR3 promotes the accumulation of CXCR3-expressing T cells during Leishmania donovani infection, this does not enhance resistance to visceral leishmaniasis; hepatic granuloma formation is impaired in CXCR3 transgenic mice PMID: 27614845 up-regulated in sepsis-induced acute lung injury PMID: 27565063 beta4GalT1 can regulate N-glycans of CXCR3 in RA. N-glycans of CXCR3 affects CXCL10/CXCR3 ligand-binding which enhancing fibroblast-like synoviocytes invasion. PMID: 28215986 this study shows that diosgenin-mediated anti-allergic effects are associated with increased number of Foxp3+ Treg cells expressing CXCR3 PMID: 27886644 Circulating levels of chemokines that activate CXCR3 are elevated in non-obese diabetic (NOD) mice, consistent with clinical findings in human diabetes. PMID: 27325565 CXCR3 interacts with IL-10 secreted by CD8+CD122+ regulatory T cells in a mouse model of Acute Lung Injury and promotes interferon-gamma and CXCL10 release. PMID: 26475448 This study demonstrates a previously unrecognized role of CXCR3 signaling in glial cells in negatively regulating Th17 cell expansion during experimental autoimmune encephalomyelitis PMID: 27068264 CXCR3 was also linked to steatosis through inducing hepatic lipogenic genes PMID: 26394162 findings demonstrate that targeting CXCR3 is effective in both tumor and host compartments, and suggest that CXCR3 inhibition is likely to avoid adverse effects on host cells PMID: 26485767 Activation of the CXCL10/CXCR3 pathway has an important role in retinal inflammation and neuronal injury after high intraocular pressure-induced ischemia. PMID: 26448323 STAT3 in CD8+ T Cells Inhibits Their Tumor Accumulation by Downregulating CXCR3/CXCL10 Axis PMID: 26025380 CXCR3-mediated trafficking of regulatory T cells could represent a mechanism of homeostatic immunoregulation during diabetogeneesis. PMID: 25946021 These studies identify CXCR3-mediated trafficking at the tumour vascular interface as a critical checkpoint to effective T-cell-based cancer immunotherapy. PMID: 26109379 activated T cells display a subtle distance-dependent chemotaxis toward clusters of infected cells and this is mediated by CXCR3 and its ligands. PMID: 26525288 results suggest that CXCR3 plays an important role in recruiting proinflammatory cells to the colon during colitis and that CXCR3 may be a therapeutic target to reduce the influx of proinflammatory cells in the inflamed colon. PMID: 24992040 MOG(1-125) immunization resulted in an increased incidence of severe experimental autoimmune encephalomyelitis and was accompanied by an increased percentage of CXCR3-expressing CD4+ T cells producing IFNgamma in the CNS. PMID: 24552747 Data indicate that dipeptidylpeptidase 4 (DPP4) diminishes chemokine CXCL10 expression and limits CXC Chemokine Receptor 3 (CXCR3)-mediated antitumor immunity. PMID: 26075911 Maternal CD8+ T cells with fetal specificity upregulated expression of the chemokine receptor CXCR3 and were essential for L. monocytogenes-induced fetal resorption in prenatal L. monocytogenes infection. CXCR3 knockout or blockade prevented this. PMID: 25751061 The anti-fibrotic effects of CXCL10 in the healing infarct and in isolated cardiac fibroblasts are CXCR3-independent and may be mediated through proteoglycan signalling PMID: 24891401 CXCR3-dependent recruitment of cells to inflamed areas was critical for development of the CD8-positive, CD103-negative T lymphocyte population and pathogen clearance. PMID: 25706747 CXCR3 enables local CD8(+) T cell migration for the destruction of virus-infected keratinocytes. PMID: 25769612 CXCR3 signaling mediates development of Alzheimer disease-like pathology in APP/PS1 mice. PMID: 25500888 The CXCR3 chemokine system is critically involved in the intrinsic glial activation during cuprizone-induced demyelination, which significantly modulates the distribution of glial cells and the local cytokine milieu. PMID: 24930935 plays a role in insulin resistance and obesity-induced visceral adipose inflammation PMID: 24124129 this is the first report that demonstrates a role for CXCR3 in macrophage polarization and subsequent breast tumor outcomes PMID: 24679047 In our mouse model, fatal progression of AIH is mediated by IL-18-dependent differentiation of T cells into Th1 cells and effector T cells, respectively, and that CXCR3-CXCL9 axis-dependent migration of those T cells is crucial for fatal progression. PMID: 24700550 CXCR3 contributes to T-cell accumulation in periepididymal adipose of obese mice. PMID: 24812325 CCR4 and CXCR3 play different roles in the migration of T cells to inflammation in skin, arthritic joints, and lymph nodes. PMID: 24700244 CXCR3 is critical to the skin-selective effector T-cell recruitment underlying autoreactive GVHD PMID: 24390137 Data indicate that NOD2 is required for CXCR3-dependent small intestinal (SI) CD8(+) T cell migration during T cell activation. PMID: 24591373 results establish a central role for CXCR3 in coordinating innate and adaptive immunity, ensuring generation of Th1 effectors and their trafficking to the frontline of infection to program microbial killing by inflammatory monocytes. PMID: 24130498 blockade or genetic deficiency of either CXCR3 or of its primary ligand has no impact on clinical experimental autoimmune encephalomyelitis induced by the adoptive transfer of highly polarized Th1 effector cells. PMID: 23873018 The data show that CCL21 and CXCR3 have dichotomous functions in traumatic and autoimmune encephalomyelitis-evoked neuropathic pain suggesting PMID: 23643685 Expression of the chemokine receptor CXCR3 was critical for memory CD8(+) T cells to populate the airways during the steady state. IL-12 signaling shortly after immunization limited CXCR3 expression on memory CD8(+) T cells. PMID: 24238342 early differentiated CD138(high)MHCII(+) rather than terminally differentiated CD138(high)MHCII(low) plasma cells may be involved in the renal inflammatory injury in lupus, due to CXCR3 expression and IgG secretion. PMID: 23520491

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.