Recombinant Mouse C-X-C Chemokine Receptor Type 3 (CXCR3) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-04852P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse C-X-C Chemokine Receptor Type 3 (CXCR3) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-04852P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mouse C-X-C Chemokine Receptor Type 3 (CXCR3) Protein (His-KSI) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | O88410 |
| Target Symbol | CXCR3 |
| Synonyms | Cxcr3; Cmkar3; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183 |
| Species | Mus musculus (Mouse) |
| Expression System | E.coli |
| Tag | N-6His-KSI |
| Target Protein Sequence | MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR |
| Expression Range | 1-52aa |
| Protein Length | Partial |
| Mol. Weight | 21.3 kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response. Binds to CCL21. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. |
| Protein Families | G-protein coupled receptor 1 family |
| Database References | KEGG: mmu:12766 STRING: 10090.ENSMUSP00000052444 UniGene: PMID: 28358049 |
