Recombinant Mouse C-Type Lectin Domain Family 4 Member E (CLEC4E) Protein (His)

Name: Recombinant Mouse C-Type Lectin Domain Family 4 Member E (CLEC4E) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08708P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse C-Type Lectin Domain Family 4 Member E (CLEC4E) Protein (His) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9R0Q8
Target Symbol	CLEC4E
Synonyms	Clec4e; Clecsf9; Mincle; C-type lectin domain family 4 member E; C-type lectin superfamily member 9; Macrophage-inducible C-type lectin; Mincle
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
Expression Range	46-214aa
Protein Length	Extracellular Domain
Mol. Weight	23.6kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Calcium-dependent lectin that acts as a pattern recognition receptor (PRR) of the innate immune system: recognizes damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) of bacteria and fungi. The PAMPs notably include mycobacterial trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid with potent adjuvant immunomodulatory functions. Interacts with signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 (Th1) and T-helper 17 (Th17) cell subtypes. Also recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia and mediates macrophage activation. Through recognition of DAMPs released upon nonhomeostatic cell death, enables immune sensing of damaged self and promotes inflammatory cell infiltration into the damaged tissue.
Subcellular Location	Cell membrane; Single-pass type II membrane protein. Cell projection, phagocytic cup.
Database References	KEGG: mmu:56619 STRING: 10090.ENSMUSP00000032239 UniGene: PMID: 28112221 Mincle activation by cholesterol sulfate causes the secretion of a range of proinflammatory mediators in response to skin damage. PMID: 28292894 this study shows that mincle inhibits neutrophils and macrophages apoptosis in Aspergillus fumigatus keratitis PMID: 28888778 Mincle is induced specifically on M1 macrophages, where Mincle-Syk signaling promotes and maintains inflammatory phenotypes of M1 macrophages in acute renal inflammation. PMID: 28017324 work implicates a novel innate immune driver of Con A hepatitis and, more broadly, suggests a potential role for Mincle in diseases governed by sterile inflammation. PMID: 27559045 Mincle deletion results in TLR4-mediated inflammation. PMID: 26747838 Priming by Mincle-deficient dendritic cells (DCs). PMID: 27742545 this study shows that immune activation in vitro and in vivo by trehalose esters of simple fatty acids requires two acyl chains of length and involves Mincle PMID: 27252171 Attenuated neutrophil extracellular trap formation in Mincle-/- neutrophils correlates with impaired autophagy activation in vitro and in vivo, whereas reactive oxygen species formation in these neutrophils remained intact. PMID: 28186242 We here show that Mincle gene expression was induced in alveolar macrophages and neutrophils in bronchoalveolar lavage fluids of mice and patients with pneumococcal pneumonia PMID: 27923071 this study shows a significant role for Mincle in Pneumocystis modulating host defense during infection PMID: 28298521 The authors report that microbial stimulation triggers Mincle (Clec4e) expression through the myeloid differentiation primary response gene 88 (MyD88) pathway; a process that does not require MCL (Clecsf8, Clec4d). Conversely, they show that MCL is constitutively expressed but retained intracellularly until Mincle is induced, whereupon the receptors form heterodimers which are translocated to the cell surface. PMID: 27005451 a nonredundant role for Clec4e in coordinating major biological pathways involved in atherosclerosis PMID: 27587433 this paper shows that mycobacterial cell envelope glycolipid TDM modulates TLR2-mediated IL-10 and IL-12p40 responses in macrophages through Mincle, which is, in turn, up-regulated by Mycobacterium bovis BCG PMID: 26939595 Data show that Mincle, the inducible receptor for mycobacterial cord factor, is the key switch for the transition of macrophages from cytokine expression to high nitric oxide production. PMID: 27089465 work shows parallel networks of necroptosis-induced CXCL1 and Mincle signalling that promote macrophage-induced adaptive immune suppression and thereby enable pancreatic ductal adenocarcinoma progression PMID: 27049944 The results indicate differential roles for Dectin-2 and Mincle in the generation of adaptive immune responses to F. pedrosoi fungal infection in mice. PMID: 26140582 Mincle is essential for the activation of macrophages by trehalose glycolipids, the receptor does not play a role in the uptake of these glycolipids or of glycolipid-coated particles. PMID: 25645884 These results suggest that MCL positively regulates Mincle expression through protein-protein interaction via its stalk region, thereby magnifying Mincle-mediated signaling. PMID: 25888641 Collectively, authors show that expression of Mincle, particularly by classical dendritic cells, contributes to the control of splenic Mycobacterium bovis BCG infection in mice. PMID: 25332121 Trehalose 6,6'-dimycolate-induced Mincle expression is dependent on Dectin-3-mediated NF-kappaB activation through the CARD9-BCL10-MALT1 complex. PMID: 25202022 identify C/EBPbeta as central hub in Mincle expression and inflammatory gene induction, whereas HIF1alpha controls Nos2 expression. PMID: 25156364 These results demonstrated that GroMM is a unique ligand for human Mincle that is not recognized by mouse Mincle. PMID: 24733387 These results demonstrate protective role of Mincle in host defense against K. pneumoniae pneumonia by coordinating bacterial clearance mechanisms of neutrophils. PMID: 24353272 Solvent-based fractionation revealed that Mincle and Dectin-2 recognize lipophilic and hydrophilic components of Malassezia. PMID: 23601109 that absence of the innate receptor Mincle can be fully compensated for in vivo in terms of sensing Mtb and mounting a protective inflammatory immune response. PMID: 22784441 The expression profile of Mincle is studied on resident alveolar macrophages as well as inflammatory elicited lung exudate macrophages and neutrophils and its role in protective immunity against Mycobacterium bovis BCG challenge in mice. PMID: 22869905 silencing of renal DNaseI gene expression initiates a cascade of inflammatory signals including activation of Toll like receptors and Clec4e, leading to progression of both murine and human lupus nephritis PMID: 22479529 The physiological relevance of the Mincle-mediated anti-TDM immune response was confirmed by defective immune responses in Mincle/ mice upon aerosol infections with Mtb. PMID: 22496642 Mincle is a key C-type lectin receptor for mycobacterial cord factor and controls T helper cell type (Th)1/Th cell type (Th)17 adjuvanticity of cord factor trehalose-6,6-dimycolate (TDM) and trehalose-6,6-dibehenate (TDB). PMID: 20164423 findings show that Mincle plays a novel and nonredundant role in the induction of inflammatory signaling in response to C. albicans infection PMID: 18490740 Mincle is a receptor that senses nonhomeostatic cell death and thereby induces the production of inflammatory cytokines to drive the infiltration of neutrophils into damaged tissue. PMID: 18776906 Mincle may recognize specific geometry of alpha-mannosyl residues on Malassezia species and use this to distinguish them from other fungi. PMID: 19171887

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.