Recombinant Mouse C-C Motif Chemokine 7 (CCL7) Protein (His)

Name: Recombinant Mouse C-C Motif Chemokine 7 (CCL7) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08351P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse C-C Motif Chemokine 7 (CCL7) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q03366
Target Symbol	CCL7
Synonyms	Ccl7; Fic; Mcp3; Scya7C-C motif chemokine 7; Intercrine/chemokine MARC; Monocyte chemoattractant protein 3; Monocyte chemotactic protein 3; MCP-3; Protein FIC; Small-inducible cytokine A7
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Expression Range	28-97aa
Protein Length	Partial
Mol. Weight	12.1kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity.
Subcellular Location	Secreted.
Protein Families	Intercrine beta (chemokine CC) family
Database References	KEGG: mmu:20306 STRING: 10090.ENSMUSP00000021011 UniGene: PMID: 28046055 Our results demonstrate that CCL7 is required for maximal ovalbumin-induced ocular anaphylaxis, mast cell recruitment in vivo, and maximal FcepsilonRI-mediated mast cell activation in vitro PMID: 27956527 Periprostatic adipocytes drive prostate cancer progression in obesity via CCL7 secretion which stimulates CCR3 expressing tumor cells. PMID: 26756352 TFPI has an anti-proliferative role in TNF-alpha stimulated-VSMCs at least partly by interfering with the MCP-3/CCR2 pathway and then via suppression of the ERK1/2 and PI3K/AKT signaling pathways PMID: 26302185 Our data highlight a pivotal role of CCL7 and IRF-7 in rhinovirus-induced inflammation PMID: 25847975 CCL7 has a dual role in the development of renal tubular interstitial fibrosis, deleterious in early stages but beneficial during later stages PMID: 23872063 These findings suggest that aortic MCP-3 overexpression may contribute to the development of atherosclerosis and hepatic steatosis under atherogenic conditions. PMID: 23462015 An increase in the expression of MCP-3 along with IL-6 histone modification at the MCP-3 promoter promotes pain sensation associated with enhanced interaction between astrocytes and microglia in the spinal cord PMID: 23364351 Electrical stimulation for 1 h significantly upregulates SDF-1 and MCP-3 expression that persists for 24 hours. PMID: 22006493 Direct anal sphincter injury results in higher levels of SDF-1 and MCP-3 expression soon after injury, whereas denervation via pudendal nerve crush results in greater SDF-1 and MCP-3 expression 10 days after injury. PMID: 21706136 Matrix metalloproteinase-2-mediated chemokine cleavage of MCP3 has an important role in cardiac inflammation as a negative feedback mechanism. PMID: 21986287 expression of the chemokine, stromal cell-derived factor-1 (SDF-1) or monocyte chemotactic protein-3 (MCP-3) may enhance homing of osteogenic cells into sites of fracture repair PMID: 21567452 CCL7 proteins were present in the vast majority of tissues investigated. mRNA for these proteins was also expressed in most of these tissues suggesting local production and the ability to respond in situ to inflammatory stimuli. PMID: 20931267 MCP-3 is significantly over-expressed in the urethral tissues of both wild-type and obese mice immediately after any urethral manipulation. Underlying obesity resulted in alterations in response to tissue injury, paralleling the degree of injury. PMID: 20970834 Monocyte chemoattractant protein-3 plays a critical role in mediating oxidative stress-induced neutrophilic airway inflammation and may have relevance in induction of neutrophilia in severe asthma. PMID: 11777981 in study of relevance of chemokine expression to selective migration of t-cells and the disease localization in murine graft-versus-host disease, mcp3 was found to be predominantly expressed in skin and heart, and not spleen and liver. PMID: 12098066 overexpression of MCP-3 in tight-skin mouse skin suggests a novel role for this protein as a fibrotic mediator activating extracellular matrix gene expression in addition to promoting leukocyte trafficking. PMID: 12847692 These results indicate that CCR7-mediated cortex-to-medulla migration of thymocytes is essential for establishing central tolerance rather than for supporting the maturation or export of thymocytes. PMID: 16473829 a novel mechanism for the recruitment of CCR10-positive T cells to skin-draining LN following the rapid release of preformed CCL27 from the epidermis. PMID: 18453562 Cross-talk between MCP-3 and TGFbeta may be critical in the development of fibrosis. PMID: 19038247 Up-regulated MCP-3 production does not compensate for loss of MCP-1; MCP-3 appears to be a less effective mediator of monocyte recruitment than MCP-1. PMID: 19641140

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.