Recombinant Mouse C-C Motif Chemokine 25 (CCL25) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08348P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse C-C Motif Chemokine 25 (CCL25) Protein (His)

Beta LifeScience SKU/CAT #: BLC-08348P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse C-C Motif Chemokine 25 (CCL25) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb O35903
Target Symbol CCL25
Synonyms Ccl25; Scya25; Teck; C-C motif chemokine 25; Chemokine TECK; Small-inducible cytokine A25; Thymus-expressed chemokine
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-6His
Target Protein Sequence GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
Expression Range 25-144aa
Protein Length Partial
Mol. Weight 18.0kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Subcellular Location Secreted.
Protein Families Intercrine beta (chemokine CC) family
Database References

KEGG: mmu:20300

STRING: 10090.ENSMUSP00000024004

UniGene: PMID: 29154408

  • MicroRNA-205 maintains T cell development following stress by regulating Foxn1 and its two regulated targets, stem cell factor and ccl25, following stress. PMID: 27646003
  • CCR9 and CCL25 expressions are induced in the early stages of airway inflammation and they have an important role modulating eosinophils and lymphocytes recruitment at the first stages of inflammatory process PMID: 27795621
  • TECK was shown to be expressed by osteoblasts, and its receptor, CCR9, by osteoclast precursors. TECK increased P. gingivalis LPS-induced osteoclast numbers in an in vitro osteoclast formation assay using osteoclast precursors. T PMID: 26921718
  • CCR9/CCL25 is involved in acute skin transplantation rejection and anti-CCL25 strategies might be useful in preventing acute rejection. PMID: 23456208
  • Accumulated CD11b(+) macrophages are critical for activating hepatic stellate cells through the CCR9/CCL25 axis and therefore promote liver fibrosis. PMID: 23460364
  • The results revealed that during an allergic reaction, CCL25 drives IL-17 gammadelta T-cell mobilization to inflamed tissue via alpha4beta7 integrin and modulates IL-17 levels. PMID: 22539297
  • CCL25/CCR9 interactions regulate inflammatory immune responses in the large intestinal mucosa by balancing different subsets of dendritic cells. PMID: 21283540
  • Characterization of mouse CCX-CKR, a receptor for the lymphocyte-attracting chemokines TECK/mCCL25, SLC/mCCL21 and MIP-3beta/mCCL19: comparison to human CCX-CKR. (CCX-CKR) PMID: 11981810
  • in vivo neutralization of the CCR9 ligand, CCL25, reduced the ability of activated CCR9(+) CD8alphabeta(+) lymphocytes cells to populate the small-intestinal epithelium PMID: 12393847
  • role of CCL25 in the generation of the small-intestinal CD8alpha alpha(+)CD3(+) intraepithelial lymphocyte compartment PMID: 12442331
  • chemokine (C-C motif) ligand 25 may thus play an important role in the adherence of mucosal lymphocytes to the microvessels of the small intestine but not the colon under uninflamed as well as inflamed conditions PMID: 14592943
  • Neonatal CD8+ splenocytes uniformly express alpha(E) integrin and exhibit a high responsiveness to CC chemokine ligand 25. With increasing age, the frequency of CD8+ alpha(E) integrin(+) splenocytes decreases, roughly correlating with thymic involution. PMID: 15187103
  • Epithelial cells and venular endothelium of small intestine are immunologically positive for CCL25, a chemokine which plays a direct role in intestinal homing of IgA antibody-secreting cells by mediating their extravasation into intestinal lamina propria. PMID: 15356112
  • Chemokine CCL25 enhances CD103-mediated adhesion to E-cadherin. PMID: 15681774
  • demonstrate a unique pattern of regulation for CCL25 and suggest a role for caudal type homeo box proteins in regulating CCL25 transcription PMID: 16517733
  • Intracellular signaling required for Ccl25-stimulated T cell adhesion mediated by the integrin alpha4beta1. PMID: 17510295
  • CCL25 is indispensable for CD8 T cells trafficking to the small intestine. PMID: 17548595
  • Demonstrate development of intestinal inflammation in Tnf(DeltaARE) mice is critically dependent on beta7 integrin-mediated T-lymphocyte recruitment. the function of the CCL25/CCR9 axis appears dispensable in this model. PMID: 18439426
  • CCL25 increases thymopoiesis after androgen withdrawal PMID: 18694999
  • Ovarian CC chemokine thymus-expressed chemokine (TECK) appears to be a chemoattractant for CD8 alpha alpha-positive cells. PMID: 19109193
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed