Recombinant Mouse C-C Chemokine Receptor Type 2 (CCR2) Protein (His&Myc)

Name: Recombinant Mouse C-C Chemokine Receptor Type 2 (CCR2) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-06978P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant transmembrane proteins – fall special offers

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse C-C Chemokine Receptor Type 2 (CCR2) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P51683
Target Symbol	CCR2
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA
Expression Range	1-55aa
Protein Length	Partial
Mol. Weight	13.6 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Key functional receptor for CCL2 but can also bind CCL7 and CCL12 chemokines. Its binding with CCL2 on monocytes and macrophages mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion. Also acts as a receptor for the beta-defensin DEFB106A/DEFB106B. Regulates the expression of T-cell inflammatory cytokines and T-cell differentiation, promoting the differentiation of T-cells into T-helper 17 cells (Th17) during inflammation. Facilitates the export of mature thymocytes by enhancing directional movement of thymocytes to sphingosine-1-phosphate stimulation and up-regulation of S1P1R expression; signals through the JAK-STAT pathway to regulate FOXO1 activity leading to an increased expression of S1P1R. Plays an important role in mediating peripheral nerve injury-induced neuropathic pain. Increases NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, which may be caused by MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. Mediates the recruitment of macrophages and monocytes to the injury site following brain injury.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	KEGG: mmu:12772 STRING: 10090.ENSMUSP00000049909 UniGene: PMID: 28778590 NOX4 is induced in early alcoholic liver injury and regulates CCR2/CCL2 mRNA stability thereby promoting recruitment of inflammatory cells and production of proinflammatory cytokines. PMID: 28383062 Ccl2-Ccr2 signaling recruits a distinct fetal microchimeric population that rescues delayed maternal wound healing. PMID: 28516946 itration reduced the potential of CCL2 to stimulate monocyte migration in diffusion gradient chemotaxis assays (p < 0.05). This was consistent with a trend towards reduced affinity of the nitrated chemokine for its cognate receptor CCR2b. PMID: 28290520 Using the Theiler's virus model of encephalitis in C57BL/6 mice study shows that CCR2 as well as CX3CR1 plays a key role in the accumulation of myeloid cells in the CNS and activation of hippocampal myeloid cells upon infection. PMID: 30181265 Enhanced bacterial clearance in CCR2(-/-) mice correlated with reduced numbers of IMs in spleens and increased numbers of neutrophils in livers. PMID: 29263104 Inflammatory CCR2(+) cells that reach the injured kidney at initial stages. PMID: 28168553 ANG II is up-regulated in serum and heart tissues of mice with EAM and that ANG II significantly drives monocyte/macrophage infiltration through the C-C chemokine receptor 2/5 (CCR2/5) axis. PMID: 29052263 this study shows that CCR-2/TLR-2 triggered signaling in murine peritoneal macrophages intensifies bacterial (Staphylococcus aureus) killing by reactive oxygen species through TNF-R1 PMID: 28736159 this paper shows CCR2(-) and CCR2(+) corneal macrophages exhibit distinct characteristics and balance inflammatory responses after epithelial abrasion PMID: 28120849 this study shows that the chemokine receptor CCR2 maintains plasmacytoid dendritic cell homeostasis PMID: 29106985 beta-arrestin2/AP-1-dependent beta2AR signaling has a critical role in the regulation of CCR2 expression and recruitment of leukocytes to the heart following injury PMID: 27956622 Although CCR2 and CX3CR1 may synergistically impact inflammatory phenotypes, their joint deficiency did not influence the metabolic effects of a 45% high-fat diet-induced obesity in these model conditions. PMID: 28650582 Chemokine receptor 2 (CCR2(+)) monocytes invade the hippocampus between 1 and 3 d after SE. In contrast, only an occasional CD3(+) T lymphocyte was encountered 3 d after SE. The initial cellular sources of the chemokine CCL2, a ligand for CCR2, included perivascular macrophages and microglia. The induction of the proinflammatory cytokine IL-1beta was greater in FACS-isolated microglia than in brain-invading monocytes PMID: 27601660 TLR9-driven inflammation induced a Ccr2-independent expansion of functionally enhanced extramedullary myeloid progenitors that correlated with the peripheral accumulation of monocytes in both wild-type and Ccr2(-/-) mice. PMID: 27621476 Suggest role for CCR2 expression in podocytes to mediate diabetic renal injury, independent of monocyte/macrophage recruitment. PMID: 27914709 CCL2 recruits T cells into the brain in a CCR2-independent manner. PMID: 28836736 in vitro and in vivo results show that CCR2 intrinsically mediates the expression of inflammatory T cell cytokines, and its absence on T cells results in attenuated colitis progression PMID: 28507030 tumor-promoting role for CCL2 acting through CCR2 on the tumor microenvironment PMID: 27820834 CCR2 expression on bone marrow-derived cells, likely macrophages, is essential to muscle regeneration independent of TLR signaling, aging, and sex. PMID: 27531927 we demonstrated that CX3CR1(Lo)CCR2(Hi) monocytes were recruited to the GBM, where they transitioned to CX3CR1(Hi)CCR2(Lo) macrophages and CX3CR1(Hi)CCR2(-) microglia-like cells. Infiltrating macrophages/monocytes constituted approximately 85% of the total TAM population, with resident microglia accounting for the approximately 15% remaining. PMID: 28235764 we characterized a novel regulatory network in macrophages, in which CCR2 activates PI3K-AKT-mTOR signaling to mediate HIF-1alpha expression, which then drives VEGF-C expression to promote lymphangiogenesis. PMID: 28627412 The findings suggest that CCR2 deficiency does not provide a sustained benefit and that Ly6C(low) macrophages may contribute to the progressive fibrosis and dysfunction of mdx(5cv) diaphragm. PMID: 27655900 In Ccr2(-/-) mice, a damaged microglia recruitment was shown in retina and this could protect the visual function in electroretinogram and alleviate the photoreceptor apoptosis. PMID: 27831552 This study establishes ECL1i as the first allosteric inhibitor of CCR2 with functional selectivity. PMID: 26979087 the individual and combined actions of CCL2/CCR2 and CX3CL1/CX3CR1 in hypoxia-induced pulmonary hypertension in mice, is reported. PMID: 28125278 Gas6 specifically promotes the recruitment of inflammatory CCR2(hi)CX3CR1(lo) monocytes through the regulation of both CCR2 and CCL2 during deep venous thrombosis. PMID: 28450294 macrophage-specific chemokine (C-C Motif) receptor 2 (Ccr2) knockout (M-Ccr2KO) and intestinal epithelial cell-specific tamoxifen-inducible Ccl2 knockout (Vil-Ccl2KO) mice, were studied. PMID: 27508875 Kupffer cells secrete CCL2 to promote CCR2-expressing neutrophil recruitment from the bone marrow and subsequent infiltration into the liver during ischemia/reperfusion injury. These findings reveal a novel pro-inflammatory role of cell-mediated CCL2-CCR2 interactions during this sterile insult. PMID: 27229110 CCR2 is dispensable for at least some forms of lung fibrosis and suggest that anti-CCR2 therapies may be ineffective in IL-17-mediated fibrotic disease. PMID: 27448666 this study shows that that CCR2 signaling is required for monocyte recruitment during Clostridium difficile colitis PMID: 27995603 this study shows that CCR2-deficient mice display enhanced resistance to Japanese encephalitis virus PMID: 27260136 this study shows that CCR-2 signaling is involved in the killing of Staphylococcus aureus by murine bone marrow cells PMID: 28409543 The results indicate that CCR2 plays an essential role in Helicobacter pylori-induced immune tolerance and shed light on a novel mechanism of CCR2-dependent dendritic cell Treg cell induction, which appears to be important in maintaining mucosal homeostasis during Helicobacter pylori infection. PMID: 27933701 CCR2(-/-) resident cardiac Macrophage favor a more antiinflammatory phenotype relative to WT controls PMID: 27327107 Endothelial VCAM-1 targeted delivery of the CCR2 antagonist resulted in inhibition of pulmonary metastases both in a murine (MC-38GFP cells) and a human xenograft (patient-derived cells) model. PMID: 26522070 To interrogate the role of CCR2 activation on Nf1(+/-) neointima formation, authors induced neointima formation by carotid artery ligation in Nf1(+/-) and WT mice with genetic deletion of either MCP1 or CCR2. Loss of MCP-1 or CCR2 expression effectively inhibited Nf1(+/-) neointima formation and reduced macrophage content in the arterial wall. PMID: 26740548 involved in Staphylococcus aureus-induced MCP-1 production via NF-kB or p38-MAPK signaling PMID: 26616292 CCL2 and its receptor CCR2 are important for the formation of osteoclasts and foreign body giant cells. PMID: 26205994 Disruption of CCR2 enhanced tau pathology and reduced cavity volume in mild traumatic brain injury. PMID: 26634348 In the absence of the rd8 allele, deficiency of CCR2 and CX3CL1 in mice leads to a mild form of retinal degeneration which is associated with the recruitment of macrophages, particularly to the subretinal space. This model enables to assess consequences of perturbed chemokine signaling, but it does not recapitulate cardinal age-related macular degeneration features. PMID: 26670885 This study introduces a model for investigating the coronary collateral circulation in mice, demonstrates that neo-collaterals form rapidly after coronary occlusion and finds that MCPCCR2-mediated recruitment of myeloid cells is required for this process PMID: 26254180 The results indicate that AMPK is a negative regulator of Ccr2 expression in RAW264.7 macrophages, and that the mechanism of action of AMPK inhibition of Ccr2 is mediated, in part, through the NF-kappaB pathway. PMID: 26799633 results demonstrate the central role CCR2 plays in mediating leukocyte mobilization from the BM, and suggest a role for CCR2 inhibition in managing monocytes/macrophages-mediated chronic inflammatory conditions PMID: 26206182 cellular fibrin uptake was diminished by elimination of CCR2-expressing cells. PMID: 26647393 CCL2/CCR2 signaling pathway may provide a novel therapeutic target to prevent renal disease progression in patients with renovascular hypertension. PMID: 26661648 In Ccr2(-/-) mice, in which monocyte-derived macrophage infiltration is impaired, silica administration induced diffuse PF with loose nodule formation and greater activation of tissue cells. PMID: 26456580 IL-23/IL-1/IFNgamma/TNFalpha/T-bet/Eomesodermin-driven circuit drives GM-CSF/IFNgamma-producing Th17 cell development. PMID: 26511769 a Th1 response in the modulation of Th2 allergic inflammation, our findings also attribute an important role to the innate response mediated by TLR9, associated with the recruitment of CCR2-dependent monocytes. PMID: 25944185 the present study shows that sildenafil modulates inflammation, with the involvement of MMP-9, MCP-1, and CCR-2, and also contributes to myelin repair. PMID: 26515692

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.