Recombinant Mouse Branched-Chain-Amino-Acid Aminotransferase, Cytosolic (BCAT1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11186P
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bcat1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bcat1.
Recombinant Mouse Branched-Chain-Amino-Acid Aminotransferase, Cytosolic (BCAT1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11186P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Branched-Chain-Amino-Acid Aminotransferase, Cytosolic (BCAT1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P24288 |
Target Symbol | BCAT1 |
Synonyms | Bcat1; Eca39Branched-chain-amino-acid aminotransferase; cytosolic; BCAT(c); EC 2.6.1.42; Protein ECA39 |
Species | Mus musculus (Mouse) |
Expression System | E.coli |
Tag | N-10His |
Target Protein Sequence | MKDCSNGCSAPFAGERGSEEVAETFRAKDLIITPATVLKEKPDPDSLVFGATFTDHMLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRMCRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPSKALLFVILSPVGPYFSSGSFTPVSLWANPKYIRAWKGGTGDCKMGGNYGASLLAQCEAVENGCQQVLWLYGKDNQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRQSILELAQQWGEFKVCERHLTMDDLATALEGNRVKEMFGSGTACVVCPVSDILYKGQMLHIPTMENGPKLASRILGKLTDIQYGRVESDWTIELP |
Expression Range | 1-386aa |
Protein Length | Full Length |
Mol. Weight | 46.4 kDa |
Research Area | Metabolism |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. |
Subcellular Location | Cytoplasm. |
Protein Families | Class-IV pyridoxal-phosphate-dependent aminotransferase family |
Database References | |
Tissue Specificity | Expressed in brain and kidney. Overexpressed in MYC-induced brain tumors, lymphomas, as well as in a teratocarcinoma cell line. |
Gene Functions References
- regulatory role in macrophage function PMID: 28699638
- results suggest transcriptional adaptations occur in BCATm KO mice that along with altered nutrient signaling may contribute to their previously reported protein turnover, metabolic and exercise phenotypes PMID: 26351290
- BCATc as a novel regulator of T cell activation and metabolism PMID: 24847056
- leucine supplementation increased the expression of enzymes (BCAT1, BCAT2 and BCKDK) that metabolize branched-chain amino acids. PMID: 24349566
- analysis of the biochemical mechanism of BCATm (branched-chain aminotransferase) catalysis of reversible transamination of leucine and alpha-ketoglutarate to KIC and glutamate PMID: 20736162
- Bcat1 is a candidate for the type I diabetes susceptibility locus Idd6 PMID: 14563018
- Bcat1 is part of the complex multigenic Pas1 locus, with a functional role for its intragenic polymorphisms in lung tumor susceptibility. PMID: 15064703
- These results demonstrate that the expression of the BCATc gene in the brain is specifically regulated by BDNF in a time- and region-dependent fashion. PMID: 16828066
- BCATc mRNA gradually appears in different brain regions starting from early stages of neural development, and is maintained until adulthood. PMID: 17150414
- BCATm(-/-) mice had elevated plasma branched-chain amino acids & decreased adiposity & body weight, despite eating more food, along with increased energy expenditure, improvements in glucose & insulin tolerance & protection from diet-induced obesity PMID: 17767905