Recombinant Mouse Biglycan (BGN) Protein (His)

Name: Recombinant Mouse Biglycan (BGN) Protein (His)
Brand: Beta LifeScience
SKU: BLC-05135P
Availability: InStock

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bgn.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Biglycan (BGN) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P28653
Target Symbol	BGN
Synonyms	Bgn; Biglycan; Bone/cartilage proteoglycan I; PG-S1
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-10His
Target Protein Sequence	DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Expression Range	38-369aa
Protein Length	Full Length of Mature Protein
Mol. Weight	43.4 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May be involved in collagen fiber assembly.
Subcellular Location	Secreted, extracellular space, extracellular matrix.
Protein Families	Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Database References	KEGG: mmu:12111 STRING: 10090.ENSMUSP00000033741 UniGene: PMID: 28882761 A novel biological pathway has been discovered of soluble biglycan inducing HIF-2alpha protein stabilization and Epo production presumably in an oxygen-independent manner, ultimately giving rise to secondary polycythemia. PMID: 27600268 Results show that Bgn plays a role in the process of angiogenesis during fracture healing, and that effect appears to be partially mediated through endostatin suppression. PMID: 27072616 Asporin deficiency changes skin glycosaminoglycan composition, and decorin and biglycan content, which may explain the changes in skin mechanical properties. PMID: 28859141 Biglycan plays a protective role during the progression of atherosclerosis in ApoE-deficient mice by inhibiting thrombin generation. PMID: 27034473 These genes were concordantly induced by TAC in WT but not in biglycan KO mice. CONCLUSIONS: Left ventricular pressure overload induces biglycan expression in cardiac fibroblasts. Ablation of biglycan improves cardiac function and attenuates left ventricular hypertrophy and fibrosis after long-term pressure overload. PMID: 27789290 Importance of biglycan and decorin as targets for the manipulation of fetal membrane extracellular matrix stability in the context of inflammation. PMID: 25914258 Biglycan deficiency leads to loosely packed aortic collagen fibers, increased susceptibility of aortic elastin fibers to angII-induced stress, and up-regulation of vascular perlecan content. PMID: 25093698 Biglycan signaling supported fetal membrane remodeling during early gestation in the absence of concomitant changes in TGFbeta levels. PMID: 24373743 Lumican and biglycan influence corneal keratocyte lamellipodia organization and are critical in the regulation of stromal collagen fibrillogenesis. PMID: 24447998 Biglycan-triggered TLR-2- and TLR-4-signaling exacerbates the pathophysiology of ischemic acute kidney injury. PMID: 24480070 De novo expression of circulating biglycan evokes an innate inflammatory tissue response via MyD88/TRIF pathways. PMID: 24361484 Early stage patellar tendon healing was inferior in biglycan-null and decorin-null mice as compared to wild type. PMID: 24157578 This suggests that biglycan and decorin may have sequential roles in the tendon response to injury. PMID: 24072490 Mast cell chymase degrades the alarmins heat shock protein 70, biglycan, HMGB1, and interleukin-33 (IL-33) and limits danger-induced inflammation. PMID: 24257755 extracellular matrix biglycan mediates breast cancer normalization induced by embryonic mesenchyme PMID: 23817524 Biglycan plays a role in tendon viscoelasticity that cannot be completely explained by its role in collagen fibrillogenesis. PMID: 23592048 Biglycan deletion alters adiponectin expression in murine adipose tissue and 3T3-L1 adipocytes. PMID: 23189205 The glycosaminoglycans chains of biglycan (BGN) promote BGN-assisted BMP-4 function. PMID: 22895561 Bgn inhibits the major properties of HER-2/neu-transformed cells, which is inversely modulated by the PKC signaling cascade. PMID: 22582394 Increased messenger RNA (mRNA) expression of extracellular matrix genes BGN and COL1A1 was observed in the mouse epididymal adipose tissue after high-fat diet. PMID: 21775118 Biglycan/decorin mixed double knockout mouse is a model of dystocia and delayed labor onset. PMID: 22253749 Extracellular matrix protein biglycan plays a novel role in regulating synapse stability. PMID: 22396407 Use of a transplant system and a fracture healing model revealed that expression of Wnt-induced secreted protein 1 was decreased in bone formed by biglycan-deficient cells, further suggesting reduced Wnt signaling in vivo. PMID: 21969569 Biglycan is expressed/developmentally regulated in placenta and fetal membranes; data from mutant mouse strains suggest that both biglycan and decorin contribute to gestational success (i.e., prevent premature birth). PMID: 21502335 critical for temporomandibular joint subchondral bone integrity PMID: 21917603 Biglycan and decorin reduced the proliferation of pre-adipocytes, partly by induction of apoptosis. Furthermore, the anti-proliferative capabilities of decorin and biglycan were nullified with removal of GAG side-chains. PMID: 21702857 bgn deficiency promotes myofibroblast differentiation and proliferation in vitro and in vivo likely due to increased responses to TGF-beta and SMAD2 signaling PMID: 21454527 Biglycan and fibromodulin are novel key players in regulating chondrogenesis and extracellular matrix turnover during temoporomandibular joint osteoarthritis pathology. PMID: 20035055 Biglycan deficiency significantly accelerated disc degeneration in mice. PMID: 19940720 Beta1 integrin and htis protein's binding sites are localized to different laminin-G-domain-like (LG) modules within the laminin alpha5 chain G domain. PMID: 12519075 decorin and biglycan play distinct roles in palatogenesis, and decorin was more actively involved in the process of secondary palate formation than biglycan. PMID: 12666199 biglycan deficient mice have diminished capacity to produce marrow stromal cells, the bone cell precursors, and this deficiency increases with age PMID: 12975603 Deficiency protects against increased trabecular bone turnover and bone loss in response to estrogen depletion. PMID: 14672350 bgn is required for retaining an appropriate microenvironment for the maturation of osteoblastic stem cells PMID: 15173106 In addition to the imbalance between differentiation and proliferation, there was a differential decrease in secretory leukocyte protease inhibitor (slpi) in bgn deficient osteoblasts treated with 1,25-(OH)(2)D(3) PMID: 16364709 biglycan is important for the maintenance of muscle cell integrity and plays a direct role in regulating the expression and sarcolemmal localization of the intracellular signaling proteins dystrobrevin-1 and -2, alpha- and beta1-syntrophin and nNOS PMID: 16807372 biglycan has a particularly important function during muscle and connective tissue development PMID: 16810681 Biglycan is a ligand for two members of the sarcoglycan complex and regulates their expression at discrete developmental ages. PMID: 16883602 Biglycan is a positive modulator of BMP-2 induced osteoblast differentiation PMID: 17120779 At embryonic day 18.5, alizarin red/alcian blue staining showed that the Bgn/Dcn double deficient mice had hypomineralization of the frontal and parietal craniofacial bones. PMID: 17188951 death of biglycan-deficient mice from aortic rupture implicates biglycan as essential for the structural and functional integrity of the aortic wall and implicates biglycan gene defects in the pathogenesis of aortic dissection and rupture PMID: 17502576 These preliminary data suggest that WISP-1 and BGN may functionally interact and control each other's activity, thus regulating the differentiation and proliferation of osteogenic cells. PMID: 18701807 Biglycan overexpression did not significantly affect the amelogenin expression in incisor and molar teeth in 3-day postnatal transgenic mice. PMID: 18727043 decorin has a primary role in regulating fibril assembly, a function that can be fine-tuned by biglycan during early development. PMID: 19136671 Findings indicate that normal expression of small leucine rich proteoglycans, such as biglycan and decorin, plays an important role in the highly orchestrated process of dentin mineralization. PMID: 19379665 By signaling through TLR2/4, biglycan stimulates the expression of NLRP3 and pro-IL-1beta mRNA. PMID: 19605353 Binds to the carboxyl-terminal third of the alpha-dystroglycan core polypeptide. This interaction requires the chondroitin sulfate side chains of biglycan. PMID: 10684260

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.