Recombinant Mouse Beta-Defensin 1 (DEFB1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04137P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Beta-Defensin 1 (DEFB1) Protein (His-SUMO)

Beta LifeScience SKU/CAT #: BLC-04137P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Beta-Defensin 1 (DEFB1) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P56386
Target Symbol DEFB1
Synonyms Defb1Beta-defensin 1; BD-1; mBD-1; Defensin; beta 1
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-6His-SUMO
Target Protein Sequence DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
Expression Range 33-69aa
Protein Length Full Length of Mature Protein
Mol. Weight 20.1kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
Subcellular Location Secreted. Membrane.
Protein Families Beta-defensin family
Database References

KEGG: mmu:13214

STRING: 10090.ENSMUSP00000051754

UniGene: PMID: 25881202

  • these studies demonstrate a role for the murine beta-defensin 1 peptide in early control of Candida infection in a murine model of mucosal candidiasis PMID: 25595775
  • Akt1 is involved in the regulation of defensin expression and the innate immune response important for bacterial clearance PMID: 21559496
  • Histopathology showed a greater inflammatory influx in the lungs of mBD-1((-/-)) mice at Day 3 postinfection compared with WT C57BL/6 mice PMID: 21551252
  • The decreased production of antimicrobial peptides by burn-site epidermal keratinocytes influenced by Gr-1(+)CD11b(+) cells was shown to be restored by glycyrrhizin. PMID: 19843573
  • elimination of mBD-1 results in a defect in the ability of the host to clear H. influenzae from the lung, which is most consistent with this peptide functioning as an antibiotic at the airway surface. PMID: 12010999
  • Murine beta-defensins-1 and -4 were present in newborn skin. PMID: 12612195
  • The expression of BD1 was significantly elevated in the lungs of cigarette smoke-exposed mice compared with air-exposed mice. PMID: 18699806
  • Although both murine beta-defensin (mBD)-1 and mBD2 are constitutively expressed in normal BALB/c and C57BL/6 corneas, mBD-1 is not required for host resistance against Pseudomonas aeruginosa-induced corneal infection. PMID: 19155510
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed