Recombinant Mouse Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3 (BNIP3) Protein (His)

Name: Recombinant Mouse Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3 (BNIP3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-02208P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3 (BNIP3) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O55003
Target Symbol	BNIP3
Synonyms	Bnip3; Nip3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLK
Expression Range	1-156aa
Protein Length	Partial
Mol. Weight	21.6 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. Plays an important role in the calprotectin (S100A8/A9)-induced cell death pathway.
Subcellular Location	Mitochondrion. Mitochondrion outer membrane; Single-pass membrane protein.
Protein Families	NIP3 family
Database References	KEGG: mmu:12176 STRING: 10090.ENSMUSP00000101718 UniGene: PMID: 30056271 JNK activates Mff and Bnip3, contributing to the fatal mitochondrial fission and mitophagy, respectively. PMID: 29149759 BNIP3 expression was upregulated in hypoxic keratinocytes, and BNIP3 silencing suppressed hypoxia-induced cell migration. PMID: 27783443 In a neuronal model of dominant optic atrophy, BNIP3 down-regulation reduced autophagy and mitophagy. PMID: 27861891 Down-regulation of Bcl2/adenovirus E1B 19-kDa-interacting protein 3 (BNIP3) by olomoucine, a cyclin-dependent kinasesinhibitor, reduces lipopolysaccharide - and nitric oxide-induced cell death in BV2 microglial cells. Olomoucine may protect cells by limiting proinflammatory responses, thereby reducing nitric oxide generation. PMID: 27345388 data outline Bnip3 as a key effector of PPARgamma-mediated adipose mitochondrial network fragmentation, improving insulin sensitivity and limiting oxidative stress. PMID: 27325287 the results suggest that BNIP3 plays a vital role in regulating PINK1 mitochondrial outer membrane localization, the proteolytic process of PINK1 and PINK1/parkin-mediated mitophagy under physiological conditions. PMID: 27528605 BNIP3 interacts with the mitochondrial outer membrane directly via mitochondrial BAX. PMID: 28333095 Data show that TGFbeta-activated kinase-1 (TAK1) activated nuclear factor of activated T-cells (NFAT)/NF-kappa B (NFkappaB), downregulated BCL2-adenovirus E1B interacting protein 3 (Bnip3), and inhibited cardiac cell death. PMID: 26564789 propose that BNIP3 acts as a brake on HIF-1 activity serving to increase rates of mitophagy in response to hypoxia and to limit production of damaging ROS that would further amplify HIF-1 expression and promote tumor progression to metastasis PMID: 26232272 Results suggest that Bnip3 regulates cardiac gene expression and perhaps myocyte morphology by activating nuclear p300 acetyltransferase and hyperacetylating histones and its selective transcription factors. PMID: 26317696 Bnip3 dual-functionality and crosstalk between mitophagy and apoptosis pathways is presented here. PMID: 26253153 regulates mitophagy during hypoxia, whereas NIX is required for mitophagy during development of the erythroid lineage. PMID: 25753537 role in the generation of robust NK cell memory in the process of mitophagy during viral infection PMID: 26253785 BNIP3 primarily regulates basal level of mitophagy in physiological conditions, whereas BNIP3 exclusively activates excessive mitophagy leading to cell death. PMID: 25230377 Bnip3 generation, mediated by PARP1, causes mitochondrial damage and neuron death. PMID: 25429139 Suggest pro-tumorigenic role of BNIP3 driving melanoma cell's aggressive features, like migration and vasculogenic mimicry. PMID: 24625986 BNIP3 has a protective effect against UVB-induced apoptosis in keratinocytes PMID: 24402046 The BNIP3 cell death pathway may be a new target for protecting oligodendrocytes from death after stroke PMID: 23692407 Bnip3 is a required downstream effector of FoxO-driven autophagic flux in mechanically unloaded failing myocardium. PMID: 23568341 These results uncover a mechanism of cavitation through hypoxia-induced apoptosis of the core cells mediated by HIFs, Bnip3, and AIF. PMID: 22753893 Loss of BNip3 resulted in increased lipid synthesis in the liver that was associated with elevated ATP levels, reduced AMP-regulated kinase (AMPK) activity, and increased expression of lipogenic enzymes. PMID: 22547685 our mouse model demonstrates a balance between BNIP3-mediated autophagy and H-ras(val12)-induced tumor formation and reveals that H-ras(val12) induces autophagy in a BNIP3-dependent manner. PMID: 22241963 The role of HIF-1alpha or NBIP3 in hypoxia-induced authophagy activation and osteoclastogenesis is reported. PMID: 21465467 Expression of NOV and BNIP3 in leukemia AML-M(4) is significantly higher than that in normal controls. PMID: 21518474 Suggest that induction of mitochondrial autophagy in response to Bnip3 is a protective response activated by the cardiac myocytes that involves Drp1-mediated mitochondrial fission and recruitment of Parkin. PMID: 21890690 enforced and endogenous expression of Ras coincided with the up-regulation of BNIP3 across a wide spectrum of cancer cells, providing the first experimental evidence that BNIP3 is a regulatory target of H-Ras PMID: 21868531 Bnip3 caused an increase in mitochondrial protease activity, suggesting that Bnip3 might promote degradation of proteins in the mitochondria. PMID: 21278801 findings reveal a novel intrinsic defense mechanism that opposes the mitochondrial defects and cell death of ventricular myocytes that is obligatorily linked and mutually dependent on alternative splicing of Bnip3FL during hypoxia or ischemic stress PMID: 21415393 Expression of MAFbx and Bnip3 was increased in hearts of mice in bearing colonic tumors. PMID: 21167183 Bnip3 mediates mitochondrial permeabilization by a novel mechanism that is different from other BH3-only proteins PMID: 20025887 Bnip3 is important in the cardiomyocyte death pathway after severe hypoxia. PMID: 20160671 The expression of PLAGL2 leads to the mRNA expression of a proapoptotic factor, Nip3 PMID: 11832486 Promoter analysis showed that the region between -281 and -1 of the 5'-upstream enhancer region of murine BNIP3 was sufficient for nitric oxide-dependent expression of BNIP3 PMID: 15358175 Data suggest that Bnip3-mediated upregulation of autophagic activity constitutes a protective response against Bnip3 death signaling. PMID: 16874059 Results identify BNIP3 as a key regulator of hypoxia-induced autophagy and suggest a novel role for the RB tumor suppressor in preventing nonapoptotic cell death by limiting the extent of BNIP3 induction in cells. PMID: 17576813 Bnip3/Bnip3L play a crucial role in anthrax lethal toxin-induced cytotoxicity, and down-regulation of Bnip3/Bnip3L is a mechanism of spontaneous or toxin-induced resistance of macrophages. PMID: 17623653 The study suggests that Bnip3 may actually allow cell survival either by preventing ATP depletion or by eliminating damaged mitochondria. PMID: 17786027 Bnip3 minimizes ventricular remodeling in the mouse. PMID: 17909626 These results suggest that BNIP-3 is a candidate for an intrinsic factor related to antidepressive effects and that Wakan-yaku theory may be useful for the identification of other intrinsic functional molecules. PMID: 18606473 Hepatic BNIP3 was also upregulated in two different models of liver stress in vivo, suggesting that a multitude of inflammatory stresses can lead to the modulation of BNIP3 PMID: 19147804 chronic intermittent hypoxia could up-regulate the expression of Nip3, and result in neuron apoptosis and ultrastructural changes in neurons of the frontal cortex PMID: 19187620 Increased cell injury and/or death could be caused directly by the upregulation of bNip3, a preapoptotic molecule that dimerizes with Bcl-2, or indirectly by the aberrant expression of SP-C-induced endoplasmic reticulum stress in epithelial cells. PMID: 19574421 BNIP3 is an important regulator of caspase-independent neural precursor cell death after hypoxia. PMID: 19915483

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Mouse Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3 (BNIP3) Protein (His)

Recombinant Mouse Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3 (BNIP3) Protein (His)

Product Overview

Target Details

FAQs