Recombinant Mouse Baculoviral Iap Repeat-Containing Protein 5 (BIRC5) Protein (His)

Name: Recombinant Mouse Baculoviral Iap Repeat-Containing Protein 5 (BIRC5) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00084P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Baculoviral Iap Repeat-Containing Protein 5 (BIRC5) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	O70201
Target Symbol	BIRC5
Synonyms	Birc5; Api4; Iap4Baculoviral IAP repeat-containing protein 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin; TIAP
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA
Expression Range	1-140aa
Protein Length	Full Length
Mol. Weight	22.3 kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. Involved in the recruitment of CPC to centromeres during early mitosis via association with histone H3 phosphorylated at 'Thr-3' (H3pT3) during mitosis. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7. Essential for the maintenance of mitochondrial integrity and function.
Subcellular Location	Cytoplasm. Nucleus. Chromosome. Chromosome, centromere. Cytoplasm, cytoskeleton, spindle. Chromosome, centromere, kinetochore. Midbody.
Protein Families	IAP family
Database References	KEGG: mmu:11799 STRING: 10090.ENSMUSP00000079124 UniGene: PMID: 29039513 While induced by exposure to reactive oxygen species generating stresses, the ultimate expression of changes in radiation response is dependent upon the bi-functionality of the tumor associated protein survivin and its intracellular translocation. PMID: 27427516 HDL-associated sphingosine 1-phosphate inhibits macrophage apoptosis by stimulating STAT3 activity and survivin expression. PMID: 28038379 Survivin also attenuates DNA damage related to PARP activation and inhibits TNFalpha-induced lipolysis, suggesting that Survivin may facilitate adipocyte maintenance in response to inflammatory stimuli. PMID: 28055005 The study assigns a new meiotic function to Cullin9 and reveals that it prevents mouse eggs from aneuploidy by regulating microtubule dynamics via survivin. PMID: 27678504 this study shows that that sorafenib promotes the survival of bone marrow cells by up-regulating survivin PMID: 27440860 Survivin was regulated by TGF-beta and was found to be highly expressed during mucosal healing following intestinal inflammation PMID: 27715398 SurvivinT34A combined with arsenic trioxide induces a loss of mitochondria membrane potential PMID: 27748945 Survivin is a key regulator of gut tissue integrity by regulating epithelial homeostasis in the stem cell niche. PMID: 26832409 TGFbetaRI inhibition in an injured adult heart could both stimulate the autocrine/paracrine activity of survivin and inhibit Wnt in CPCs to mediate cardioprotection and improve cardiac function. PMID: 26418219 Survivin is a key gene for regulating squamous cell carcinoma (SCC) cancer stem cell formation and cancer SCC development. PMID: 26771605 In colorectal cancer mice with downregulated expression of survivin, there were higher numbers of apoptotic cells and decreased expression levels of bcl2 and ki67. PMID: 26722528 survivin is essential for B cell division but does not affect survival of naive B cells. Survival of proliferating B cells may be impacted indirectly by survivin deficiency because of increased genotoxic stress caused by failed chromosomal segregation. PMID: 26810226 Survivin directly participates in PRL-mediated beta cell proliferation via Akt, STAT5-PIM and ERK signalling pathways during pregnancy PMID: 26099856 Studied competitive inhibition of survivin using a cell-permeable recombinant protein induces cancer-specific apoptosis in colon cancer model. PMID: 25678789 Results suggest a role for survivin in regulating adult neural precursor activity and inhibiting apoptosis or programmed cell death in the dentate gyrus following brain injury PMID: 25987205 NR4A1 protects pancreatic beta-cells against endoplasmic reticulum stress-mediated apoptosis by up-regulating Survivin expression and down-regulating CHOP expression. PMID: 26157144 Studies indicate the importance of survivin in Sonic hedgehog (SHH)-driven medulloblastoma (MB). PMID: 25241898 the Skp1.Cul1.F-box protein complex subunit Fbxl7 modulates mitochondrial function by controlling the cellular abundance of survivin PMID: 25778398 Both HIF1-alpha and survivin are involved in the retinal neovascularization in oxygen-induced retinopathy. PMID: 25400763 survivin-mediated radio-adaptive response is dependent upon the ability of cells to activate NFkappaB PMID: 25763931 These findings provide evidence for the existance of a posititve feedback loop connecting survivin expression in tumor cells to PI3K/Akt enhanced beta-catenin-Tcf/Lef-dependent transcription followed by secretion of VEGF and angiogenesis. PMID: 25204429 Survivin has an important role in regulating folliculogenesis and oogenesis in the adult mouse ovary. PMID: 24675472 Survivin partially regulates HSC function by modulating the Evi-1 transcription factor and its downstream targets PMID: 24903482 The study shows that the inhibition of survivin is sufficient to reduce joint inflammation and bone damage in preclinical models of arthritis PMID: 25381389 Survivin haploinsufficiency in syngeneic grafts was associated with Ischemia/reperfusion tissue injury, which triggered inflammation eventually resulting in graft loss. PMID: 24731002 UHRF1 is strongly up-regulated during liver regeneration independently of BIRC5. PMID: 24818710 Findings support the importance of adhesion molecules (VE-cadherin and CD31), survivin, and Ajuba in modulating the Hippo pathway, which regulates, in part, proliferation and survival in hemangioendotheliomas. PMID: 25266662 Survivin may be an essential mediator of cyto-protection in podocytes injury. PMID: 24747598 The survivin cascade in neural progenitor cells plays a role in anti-apoptosis. PMID: 24022164 Data suggest that toll-like receptor 3 (TLR3), phosphatidylinositol 3-kinase (PI3K), survivin, Fas ligand (FasL), and CD95 (Fas) genes are involved in the development of cervical cancer. PMID: 25106857 A 3M-CUL9-survivin pathway is implicated in maintaining microtubule and genome integrity, normal development, and tumor suppression. PMID: 24793696 Data indicate that loss of survivin in conditional Pten deletion mouse model delays prostate tumor progression. PMID: 23936028 The present studies aim to examine whether and how cilia function (Pkd1 or Pkd2) and structure (Tg737) play a role in cystic kidney and aneurysm through survivin downregulation. PMID: 24235270 Increased expression of survivin correlates with the proliferation of neural stem cells in the DG of the hippocampus soon after traumatic brain injury. PMID: 23900556 STAT3 phosphorylation and subsequent upregulation of survivin expression mediated by Notch-2 signaling in renal proximal tubule epithelial cells aid in the functional and structural recovery of the kidney from acute kidney injury. PMID: 23949800 sticky siRNAs against survivin and cyclin B1 efficiently blocks growth of established subcutaneaous B16-F10 tumors as well as formation and dissemination of melanoma lung metastases. PMID: 23835136 Data suggest survivin is a key mediator of cytoprotection in acute lung injury (as seen in antineoplastic-induced pulmonary fibrosis); survivin appears to act at epithelial/mucosal cell level; survivin action depends partly on apoptosis inhibition. PMID: 23979427 Data from Pak1 knockout mice and RNA interference in cells suggest Pak1 has role in regulation of survivin ubiquitination/stability in beta-cells; impaired proliferation of beta-cells induced by loss of PAK1 is restored by overexpression of survivin. PMID: 23514967 survivin inhibition/down-regulation with flavopiridol or specific shRNAs increased the apoptotic response of old fibroblasts to various genotoxic agents PMID: 22252435 These results suggest that OX40 costimulation crucially engages survivin during antigen-mediated Th2 responses PMID: 23616302 Thimerosal induces S phase arrest and finally causes apoptosis via inhibition of PI3K/Akt/survivin signaling. PMID: 23145070 vaccination with recombinant Fowlpox expressing survivin improves T-cell responses against aggressive Malignant mesothelioma tumors and may form the basis for promising clinical applications. PMID: 23335100 Our data support a function of survivin in hippocampal synaptic plasticity and learning and underline the importance of adult brain neurogenesis for proper operation of the hippocampal tri-synaptic circuit and the physiological functions that depend on it PMID: 23123921 This study identified a novel role for survivin in erythroblast enucleation through previously unknown protein partners. PMID: 22491741 overexpression of Bmi1 induces repressive epigenetic regulation of the promoter of Survivin, a well-characterized antiapoptotic protein. PMID: 23132836 prepared two mutant forms of the PhSurv-PhTERT tandem with two or four Sp1 sites removed from the distal "long" PhSurv promoter PMID: 23056318 Survivin prevents apoptosis by binding to caspase-3 in astrocytes infected with the BeAn strain of Theiler's murine encephalomyelitis virus. PMID: 22638909 these data suggest a potentially novel role for survivin in functionally promoting astrocytic proliferation after intracerebral hemorrhage PMID: 22862734 Survivin is a dual regulator of lens epithelial cell proliferation and lens fiber cell differentiation. PMID: 23213276

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.