Recombinant Mouse Atp Synthase Subunit Beta, Mitochondrial (ATP5B) Protein (His-SUMO&Myc)

Beta LifeScience SKU/CAT #: BLC-03464P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Mouse Atp Synthase Subunit Beta, Mitochondrial (ATP5B) Protein (His-SUMO&Myc)

Beta LifeScience SKU/CAT #: BLC-03464P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Atp Synthase Subunit Beta, Mitochondrial (ATP5B) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P56480
Target Symbol ATP5B
Synonyms Atp5f1b; Atp5b; ATP synthase subunit beta; mitochondrial; EC 7.1.2.2; ATP synthase F1 subunit beta
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-10His-SUMO&C-Myc
Target Protein Sequence YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHGS
Expression Range 230-529aa
Protein Length Partial
Mol. Weight 52.8kDa
Research Area Tags & Cell Markers
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
Subcellular Location Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Protein Families ATPase alpha/beta chains family
Database References

KEGG: mmu:11947

STRING: 10090.ENSMUSP00000026459

UniGene: PMID: 27911303

  • Results show that the relationship between ATPsyn-beta and insulin secretion deficiency suggests that ATPsyn-beta potentially could serve as a marker for type 2 diabetes mellitus disease risk in women with polycystic ovary syndrome. PMID: 28397049
  • Data show that overexpressed ATP synthase subunit-beta (ATP5b) was significantly located on renal proximal tubules in db/db mice. PMID: 26449648
  • Aging altered the expression of ATP synthase subunit beta. PMID: 25659849
  • inhibition of calmodulin (CaM) completely abolished ATPSbeta-induced Akt activation in liver cells PMID: 24296716
  • association of calcium channel alpha2/delta subunit 1 and ATP5b occurs in intracellular membranes and at the plasma membrane of developing muscle cells, where they form a signaling complex capable of accelerating the rate of decline of calcium transients PMID: 21490313
  • Adipocyte recycling of apoA-I is a selective process that involves the ectopically expressed beta-subunit of ATP synthase. PMID: 21069432
  • Disturbed flow and hypercholesterolemia synergistically promote gamma/delta T-lymphocyte activation by the membrane translocation of ATPSbeta in endothelial cells. PMID: 21193741
  • Neuron-specific changes for F(1)-complex in the Ppt1-deficient cells and give clues for a possible link between lipid metabolism and neurodegeneration in Infantile neuronal ceroid lipofuscinosis. PMID: 18245779
  • Downregulated ATP5b also reduced ATP production in the murine macrophages infected with B. anthracis spores. PMID: 18467876
  • CyPD association to the lateral stalk of ATP synthase modulates the activity of the complex PMID: 19801635
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed