Recombinant Mouse Anterior Gradient Protein 2 Homolog (AGR2) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-07693P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Mouse Anterior Gradient Protein 2 Homolog (AGR2) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-07693P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Anterior Gradient Protein 2 Homolog (AGR2) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb O88312
Target Symbol AGR2
Synonyms Protein Gob-4 (Secreted cement gland protein XAG-2 homolog)
Species Mus musculus (Mouse)
Expression System Baculovirus
Tag N-10His&C-Myc
Target Protein Sequence KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL
Expression Range 21-175aa
Protein Length Full Length of Mature Protein
Mol. Weight 21.8 kDa
Research Area Cancer
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion.
Subcellular Location Secreted. Endoplasmic reticulum.
Protein Families AGR family
Database References

KEGG: mmu:23795

STRING: 10090.ENSMUSP00000020898

UniGene: PMID: 28665039

  • AGR2 induced in ER-stressed and inflammatory pre-neoplastic pancreas is a potential marker of cancer progenitor cells with an important functional role in PDAC initiation. PMID: 27941872
  • impact of AGR2 expression and EGFR signaling on tissue regeneration PMID: 27764193
  • EGFR-mediated signaling in NCI-H460 cells is disrupted with reduced AGR2 expression. PMID: 25666625
  • AGR2 has both intracellular and extracellular effects in the intestine PMID: 25111734
  • Results indicate that DNA methylation within the AGR2 promoter modulates more aggressive cancer cell phenotypes. PMID: 24920423
  • It was concluded that: the expression of AGR2 protein was significantly higher in asthmatic mice as compared with their normal counterparts; the expression was obviously related to the expression of Muc5ac protein and IL-13. PMID: 23392704
  • Agr2 consequently serves to maintain the balance between proliferating and differentiated epithelial cells. PMID: 23209296
  • Agr2 facilitates normal lobuloalveolar development by regulating mammary epithelial cell proliferation; we found no effects on apoptosis in Agr2(-/-) mammary epithelial cells. PMID: 22819674
  • Loss of Foxp1/4 in the developing lung and in postnatal secretory epithelium leads to ectopic activation of the goblet cell fate program, in part, through de-repression of the protein disulfide isomerase anterior gradient 2 (Agr2). PMID: 22675208
  • studies implicate Agr2 in intestinal homeostasis and ER stress and suggest a role in the etiology of inflammatory bowel disease PMID: 20025862
  • AGR2 may be important for the growth and development of the intestine as well as esophageal adenocarcinomas. PMID: 18199544
  • Overexpression of Agr2 is associated with asthma. PMID: 19028979
  • AGR2 is a unique member of the protein disulfide isomerase family, with a specialized and nonredundant role in intestinal mucus production PMID: 19359471
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed