Recombinant Mouse Anterior Gradient Protein 2 Homolog (AGR2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07737P

Greater than 85% as determined by SDS-PAGE.
Recombinant Mouse Anterior Gradient Protein 2 Homolog (AGR2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07737P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Anterior Gradient Protein 2 Homolog (AGR2) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | O88312 |
Target Symbol | AGR2 |
Synonyms | Protein Gob-4 Secreted cement gland protein XAG-2 homolog |
Species | Mus musculus (Mouse) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL |
Expression Range | 21-175aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 19.9 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion. |
Subcellular Location | Secreted. Endoplasmic reticulum. |
Protein Families | AGR family |
Database References | |
Tissue Specificity | Expressed in lung, skeletal muscle, testis, liver, stomach, colon, small intestine, the goblet cells of the intestine and the mucuous neck cells of the stomach. |
Gene Functions References
- AGR2 accelerates skin wound healing through regulation of cell migration. PMID: 28665039
- AGR2 induced in ER-stressed and inflammatory pre-neoplastic pancreas is a potential marker of cancer progenitor cells with an important functional role in PDAC initiation. PMID: 27941872
- impact of AGR2 expression and EGFR signaling on tissue regeneration PMID: 27764193
- EGFR-mediated signaling in NCI-H460 cells is disrupted with reduced AGR2 expression. PMID: 25666625
- AGR2 has both intracellular and extracellular effects in the intestine PMID: 25111734
- Results indicate that DNA methylation within the AGR2 promoter modulates more aggressive cancer cell phenotypes. PMID: 24920423
- It was concluded that: the expression of AGR2 protein was significantly higher in asthmatic mice as compared with their normal counterparts; the expression was obviously related to the expression of Muc5ac protein and IL-13. PMID: 23392704
- Agr2 consequently serves to maintain the balance between proliferating and differentiated epithelial cells. PMID: 23209296
- Agr2 facilitates normal lobuloalveolar development by regulating mammary epithelial cell proliferation; we found no effects on apoptosis in Agr2(-/-) mammary epithelial cells. PMID: 22819674
- Loss of Foxp1/4 in the developing lung and in postnatal secretory epithelium leads to ectopic activation of the goblet cell fate program, in part, through de-repression of the protein disulfide isomerase anterior gradient 2 (Agr2). PMID: 22675208
- studies implicate Agr2 in intestinal homeostasis and ER stress and suggest a role in the etiology of inflammatory bowel disease PMID: 20025862
- AGR2 may be important for the growth and development of the intestine as well as esophageal adenocarcinomas. PMID: 18199544
- Overexpression of Agr2 is associated with asthma. PMID: 19028979
- AGR2 is a unique member of the protein disulfide isomerase family, with a specialized and nonredundant role in intestinal mucus production PMID: 19359471