Recombinant Mouse Angiopoietin-Related Protein 4 (ANGPTL4) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00131P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Angiopoietin-Related Protein 4 (ANGPTL4) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00131P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Angiopoietin-Related Protein 4 (ANGPTL4) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Activity Not tested.
Uniprotkb Q9Z1P8
Target Symbol ANGPTL4
Synonyms (425O18-1)(Angiopoietin-like protein 4)(Fasting-induced adipose factor)(Hepatic fibrinogen/angiopoietin-related protein)(HFARP)(Secreted protein Bk89)
Species Mus musculus (Mouse)
Expression System E.coli
Tag C-6His
Target Protein Sequence QGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Expression Range 24-410aa
Protein Length Full Length of Mature Protein
Mol. Weight 44.4 kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. May also play a role in regulating glucose homeostasis and insulin sensitivity. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro). Depending on context, may modulate tumor-related angiogenesis (Probable).; Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.
Subcellular Location Secreted. Secreted, extracellular space, extracellular matrix.
Database References

KEGG: mmu:57875

STRING: 10090.ENSMUSP00000002360

UniGene: PMID: 28867683

  • Functional studies in Angptl4-deficient mice confirm improved insulin sensitivity and glucose homeostasis. PMID: 29899519
  • Data show that angiopoietin-like protein 4 (ANGPTL4)deficiency in mice knockout (ANGPTL4(-/-)) exacerbated colonic inflammation induced by dextran sulfate sodium (DSS) or stearic acid. PMID: 28287161
  • Angptl4 is induced early in fasting to divert uptake of fatty acids and triglycerides away from adipose tissues. PMID: 28752045
  • haematopoietic ANGPTL4 deficiency increases atherogenesis through regulating myeloid progenitor cell expansion and differentiation, foam cell formation and vascular inflammation. PMID: 27460411
  • Following ANGPTL4 downregulation, the proliferation and invasion abilities of gastric cancer (GC)cell lines were suppressed as determined by MTT and Transwell assays, and cell apoptosis level and sensitivity to cisplatin were increased as determined by flow cytometry and MTT assay. In conclusion, these findings suggest that ANGPTL4 may be a new potential therapeutic target for GC PMID: 29436683
  • The influence of H2O2 on ANGPTL4 provided new insight into the mechanism of atherosclerosis. PMID: 28849063
  • The reduction of plasma triglyceride levels in Angptl4(-/-) mice and increase following Angptl4 overexpression suggest that changes in plasma triglyceride metabolism do not regulate alpha-cells in the pancreas. Our findings corroborate recent data showing that increased plasma amino acids and their transport into alpha-cells link glucagon receptor blockage to alpha-cell hyperplasia PMID: 28143927
  • study demonstrates the key role of Angptl4 in glucocorticoid-augmented hepatic ceramide production that induces whole-body insulin resistance. PMID: 28743803
  • 1) ANGPTL4 is not involved in the triglyceride-lowering effect ofbile acids ; 2) ANGPTL4 promotes bile acids absorption during taurocholic acid supplementation via a mechanism dependent on the gut microbiota. PMID: 28733267
  • physiological changes in adipose tissue ANGPTL4 expression during fasting and cold resulted in inverse changes in the amount of mature-glycosylated LPL in wild-type mice, but not Angptl4(-/-) mice. We conclude that ANGPTL4 promotes loss of intracellular LPL by stimulating LPL degradation after LPL processing in the endoplasmic reticulum (ER). PMID: 27034464
  • Angptl4-deficient mice show impaired insulin secretion and dysmorphic pancreatic islets. PMID: 28188788
  • Angptl4 induces obesity-associated metabolic disorders. The present study suggested that Angptl4 promotes liver steatosis and lipolysis, in addition to impairing liver function; while Angptl4 improves glucose tolerance and insulin resistance, in addition to causing the downregulation of various insulin signaling pathway-associated genes. PMID: 27573470
  • ANGPTL4 is part of a shuttling mechanism that directs fatty acids derived from circulating triglyceride-rich lipoproteins to brown adipose tissue during cold. PMID: 26476336
  • these results suggest that IL-1beta increases Angptl4 expression through a mechanism dependent on the JNK-MAPK signaling pathway in MC3T3-E1 cells. PMID: 26069075
  • glucagon receptor antagonist improves glycemia in diet-induced obese angptl4 knockout mice without increasing glucagon levels or alpha-cell proliferation, underscoring the importance of this protein. PMID: 26621734
  • This study showed that phloridzin improved plasma lipoprotein lipase activity via a decrease of ANGPTL4 mRNA expression and an increase of AMP-activated protein kinase phosphorylation. PMID: 24932810
  • Letter: Angiopoietin-like 4 is induced during sebocyte differentiation and regulates sebaceous lipogenesis in vitro but is dispensable for sebaceous gland function in vivo. PMID: 24815769
  • GR and FoxO1 are required for Angptl4 transcription activation, and that FoxO1 negatively mediates the suppressive effect of insulin PMID: 24565756
  • ANGPTL4 is a genetically and epigenetically inactivated secreted tumor suppressor that inhibits tumor angiogenesis. PMID: 23686315
  • inactivation of LPL by Angptl4 appears to occur after both proteins have traveled along the secretory pathway and arrived at the cell surface. PMID: 24220340
  • Angptl4 is necessary for rapid modulation of lipoprotein lipase activity in adipose tissue. PMID: 23176178
  • Depletion of adipose angiopoietin-like 4 abolishes intermittent hypoxia-induced dyslipidemia and atherosclerosis in mice, and is regulated by hypoxia-inducible factor-1. PMID: 23328524
  • Angptl4 suppresses foam cell formation to reduce atherosclerosis development. PMID: 23640487
  • Angptls would be useful in instances where there is a need to maintain HSCs ex vivo, such as during transduction for gene therapy applications PMID: 22639947
  • Locally expressed Angptl4 might play a role in local uterine/placental lipid metabolism. PMID: 22350948
  • The effect of Toll-like Receptor activation on the expression of macrophage ANGPTL4 was studied. PMID: 22538368
  • Angptl4 mRNA expression was increased through the elevated free FAs in diabetic mice. PMID: 22068616
  • Data showed that PPARbeta/delta regulates epidermal maturation via ANGPTL4-mediated signalling pathway. PMID: 21966511
  • ANGPTL4 tunes endothelial cell junction organization and pericyte coverage and controls vascular permeability and angiogenesis, both during development and in pathological conditions. PMID: 21832056
  • serum LDL, HDL and TG levels are decreased in LDLR-, Angptl- mice. PMID: 21549101
  • the cleavage of ANGPTL4 by these PCs modulates its inhibitory effect on LPL activity. PMID: 21398697
  • Angiopoietin-like 4 interacts with integrins beta1 and beta5 to modulate keratinocyte migration. PMID: 20952587
  • Angptl4 protects against severe proinflammatory effects of saturated fat by inhibiting fatty acid uptake into mesenteric lymph node macrophages. PMID: 21109191
  • Decreased fat storage by Lactobacillus paracasei is associated with increased levels of ANGPTL4. PMID: 20927337
  • Valsartan reduced fiaf gene expression in subcutaneous, but not visceral, fat in the ob/ob mouse. PMID: 20472602
  • Angptl4-null mice were resistant to diet-induced obesity, indicating obesity-promoting effects of Angptl4 under the condition of fat-enriched diet. PMID: 20798332
  • ANGPTL4 interacts with vitronectin and fibronectin in the wound bed, delaying their proteolytic degradation by metalloproteinases. PMID: 20729546
  • Stimulation of cardiac Angptl4 gene expression by dietary fatty acids and via PPARbeta/delta is part of a feedback mechanism aimed at protecting the heart against lipid overload and consequently fatty acid-induced oxidative stress. PMID: 20378851
  • These studies demonstrate that ANGPTL4 is a positive acute phase protein and the increase in ANGPTL4 could contribute to the hypertriglyceridemia that characteristically occurs during the acute phase response by inhibiting LPL activity. PMID: 20043872
  • potent hyperlipidemia-inducing factor in mice and inhibitor of lipoprotein lipase PMID: 12401877
  • FIAF may partially exert its function via a truncated form PMID: 15190076
  • angiopoietin-like protein 4 has an oligomerization state-dependent hyperlipidemic effect PMID: 15292369
  • Induction of Angptl4 in the heart inhibits lipoprotein-derived fatty acid delivery. PMID: 15659544
  • Differential regulation of Angptl3 & Angptl4 by sites of expression, nutritional status, & ligands of nuclear receptors may confer unique roles of each in lipoprotein metabolism. Angptl4 expression is activated by ligands of all PPAR. PMID: 15863837
  • Angptl4 is a potential angiogenic mediator in arthritis. PMID: 15870027
  • Angptl4-deficient mice had hypotriglyceridemia and increased postheparin plasma lipoprotein lipase, with greater effects in fasted state. Deficiecy in both Angptl proteins had additive effect on plasma triglycerides with survival not past 2 months of age. PMID: 16081640
  • via physical association with plasma lipoproteins, FIAF acts as a powerful signal from fat and other tissues to prevent fat storage and stimulate fat mobilization PMID: 16272564
  • First report of molecular cloning and characterization of ANGPT4in pigs, which will be helpful for a better understanding of the role of ANGPTLs in lipid metabolism. PMID: 16717449
  • Hypoxia/ischaemia rapidly increased fiaf mRNA in the injured cortex and hippocampus at 2 and 7 days after hypoxia/ischaemia. PMID: 16837853
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed