Recombinant Mouse Angiopoietin-2 (ANGPT2) Protein (His)

Name: Recombinant Mouse Angiopoietin-2 (ANGPT2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08243P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Angiopoietin-2 (ANGPT2) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O35608
Target Symbol	ANGPT2
Synonyms	Angpt2; Agpt2Angiopoietin-2; ANG-2
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	YSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPYMSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQTAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVNNSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYS
Expression Range	19-483aa
Protein Length	Partial
Mol. Weight	57.0kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
Subcellular Location	Secreted.
Database References	KEGG: mmu:11601 STRING: 10090.ENSMUSP00000033846 UniGene: PMID: 28276491 At the molecular level NLGN2 colocalizes with its neuronal partner collibystin, a CDC42 guanine nucleotide exchange factor, which is also expressed by endothelial cells and in turn modulates Angiopoietin 2 release. PMID: 29709479 ANGPT2-TIE2 signaling is essential for mesenteric lymphatic development.VEPTP (vascular endothelial protein tyrosine phosphatase) determines TIE2 response to ANGPT2. PMID: 29358379 Endothelial glycocalyx breakdown is mediated by Angpt-2 in a non-redundant manner. PMID: 28453727 These results indicate that the Angpt-Tie2 system is essential for SC integrity. The impairment of this system underlies POAG-associated pathogenesis, supporting the possibility that Tie2 agonists could be a therapeutic option for glaucoma. PMID: 28920924 ANG2 activation of Tie2 supports stable enlargement of normal nonleaky vessels, but reduction of Tie1 in inflammation leads to ANG2 antagonism of Tie2 and initiates a positive feedback loop wherein FOXO1-driven ANG2 expression promotes vascular remodeling and leakage PMID: 27548529 A balanced expression of the Ang1/Ang2 system is important for islet physiology. Ang-2 prevents beta-cell mass and islet vascular adaptation in response to HFD feeding with no major influence on glucose homeostasis PMID: 27617438 These results underscore a pivotal role of Kaposi's sarcoma-associated herpesvirus -induced Ang-2 in KS tumor development by promoting both angiogenesis and inflammation. PMID: 27294705 NDPKB is a protective factor in the retina, which controls Ang2 expression and the hexosamine pathway. PMID: 25900369 miR-150 is a novel suppressor of Ang2 generation with a key role in resolving vascular injury and reducing mortality resulting from sepsis. PMID: 26743170 Ang-2 blockage was beneficial as it decreased fatty streak formation and plasma triglyceride levels, but had no adverse effect on pre-existing atherosclerosis in hypercholesterolemic mice. PMID: 26062989 The results establish Ang2-mediated beta1-integrin activation as a promoter of endothelial destablization, explaining the controversial vascular functions of Ang1 and Ang2. PMID: 25635707 Alprostadil treatment can protect renal function by reducing proteinuria. These effects are mediated, at least in part, through down-regulation of Ang-2 and IL-18 expression PMID: 25200363 ANG2 as the first essential regulator of the functionally important interendothelial cell-cell junctions that form during lymphatic development PMID: 25030698 This study identifies angiopoietin-2 as a link between kidney fibrosis and arterial stiffness. PMID: 24511140 vitamin D-VDR signaling prevents lung injury by blocking the Ang-2-Tie-2-MLC kinase cascade and the renin-angiotensin system. PMID: 24196349 Angiopoietin-2 was expressed on lymphatic vessels and macrophages in inflamed cornea. While corneal LG response was abolished in Ang-2 knockout mice. PMID: 24781940 The Ang-1, Ang-2, Tie-2 system takes part in the pathologic processes in the brains that suffered acute carbon monoxide poisoning by participating in neovascularization. PMID: 23424209 Anti-angiogenic miR-542-3p directly targets the key angiogenesis-promoting protein Angpt2 to prevent tumor angiogensis. PMID: 24403060 Data report here in a definite genetic setting that Ang-2 is critical for multiple vascular permeability-inducing cytokines. PMID: 23940579 Ang-2 is involved in initial steps of the triple-negative breast cancer brain metastasis cascade PMID: 24421076 The data establish liver sinusoidal endothelial cells (LSECs) as a dynamic rheostat of liver regeneration, spatiotemporally orchestrating hepatocyte and LSEC proliferation through angiocrine- and autocrine-acting Ang2, respectively. PMID: 24458641 Myocardial upregulation of angiopoietin 2 is attenuated following thrombospondin-1 disruption. PMID: 24081879 angiopoietin-2 deficiency do not protect mice against endotoxin-induced acute kidney injury. PMID: 22872727 a protective role of Ang2 following cerebral ischemia, an action associated with a reduced BBB permeability. PMID: 23211963 LRP5-Tie2-Ang signaling axis plays a central role in control of both angiogenesis and alveolarization during postnatal lung development PMID: 22848540 Ang-2 may be involved in follicular development, atresia, ovulation, and corpus luteum formation and regression. PMID: 23350236 During liver colonization showed, colony growth and neo-angiogenesis were strongly affected by host Ang2, specifically, larger tumor volume, higher vascular density and pericyte coverage development in its absence. PMID: 22699974 a contextual model whereby differential TIE2 and integrin expression, binding, and activation control the role of ANG-2 in angiogenesis. PMID: 22585576 Studies indicate an important role of Ang2 in pancreatic vascular defects induced by hyperglycaemia. PMID: 22272235 In addition to its role during setup of the brain vasculature, Ang2 is also involved in embryonic cortical neurogenesis and in the radial migration of projection neurons. PMID: 21127017 Results indicate that blocking Ang2 inhibits metastatic dissemination in part by enhancing the integrity of endothelial cell-cell junctions. PMID: 22343031 Ang-2 acts as a crucial regulator of inflammatory lymphangiogenesis by sensitizing the lymphatic vasculature to inflammatory stimuli, thereby directly promoting lymphangiogenesis. PMID: 22058148 Studies suggest that the combined targeting of angiogenic ECs and proangiogenic TEMs by selective ANG2/TIE2-pathway inhibitors may extend the reach of vascular-targeting therapies in cancer patients. PMID: 21576085 human Ang2 antibodies are potentially therapeutic agents for ocular neovascularization in models of retinal and choroidal neovascularization, in the absence of VEGF inhibition. PMID: 21851472 Ang-2 is a novel, endothelial-derived regulator of myeloid cell infiltration that modulates beta-integrin-mediated adhesion in a paracrine manner. PMID: 21868579 In cultured brain endothelial cells exposed to hypoxia,expression of Ang-2, MMP2 and caspase 3 were elevated. PMID: 21904637 results showed Ang-2-transfected tumours displayed aberrant angiogenic vessels with few associated smooth muscle cells. No detectable differences in VEGF expression were observed between Ang-2-transfected and parental tumours. PMID: 21163623 Ang-1 treatment downregulates pulmonary inflammation, VEGF and Ang-2 expression but does not protect against vascular leakage and impaired gas exchange induced by HVT-ventilation PMID: 21179479 Ang-2 exacerbated mouse heart myocardial endothelial cells dysfunction induced by high glucose condition. PMID: 21113176 increased expression of Tie2 and Ang2 in allergic airway epithelium and alveolar macrophages, but not Ang1 or VEGF correlates with the severity of airway remodeling PMID: 20463289 Ang2 acting as an antagonist of Tie2 receptors and the reduction of Tie2 phosphorylation in endothelial cells rendering the vasculature more responsive to cytokines that promote both vascular remodeling and inflammation after M. pulmonis infection. PMID: 20952594 Angiopoietin 2 mediates inflammatory hemangiogenesis, lymphangiogenesis and neutrophil infiltration in dextran sodium sulfate-induced colitis. PMID: 19902545 Findings provide evidence that the inflammatory cytokine oncostatin M is involved in modulation of the Ang-Tie system by increasing Ang2 expression in human endothelial cells in vitro, and in murine hearts and human hearts in vivo. PMID: 20088942 Data suggest that inhibition of Angiopoietin 2 leads to normalization of tumor blood vessels by permitting the unopposed action of Ang1, but decreases tumor vascularity primarily by blocking Ang2 actions. PMID: 19815705 data show that tumor cell aggregates initiate vascular growth by angiogenic sprouting via the simultaneous expression of VEGFR-2 and Ang-2 by host and tumor endothelium PMID: 11901186 Orchestrates angiogenesis and arteriovenous contribution PMID: 12048246 Angiopoietin-2 plays an important role in retinal angiogenesis PMID: 12115724 Ang2 signals are required for the proper development and function of the lymphatic vessels. PMID: 12361591 Angiopoetin 2 is required for postnatal angiogenesis and lymphatic patterning. PMID: 12361603

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.