Recombinant Mouse Allograft Inflammatory Factor 1 (AIF1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07258P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mouse Allograft Inflammatory Factor 1 (AIF1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07258P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mouse Allograft Inflammatory Factor 1 (AIF1) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O70200 |
Target Symbol | AIF1 |
Species | Mus musculus (Mouse) |
Expression System | Yeast |
Tag | C-6His |
Target Protein Sequence | SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP |
Expression Range | 2-147aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 17.8 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. |
Subcellular Location | Cytoplasm, cytoskeleton. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, phagocytic cup. |
Database References | |
Tissue Specificity | Abundantly expressed in the testis, moderately in the spleen and lymph nodes and at low levels in the liver and thymus. Detected in macrophages. |
Gene Functions References
- Aif1 is important for bacterial and particle transcytosis in M cells. PMID: 28224999
- These findings indicate that the expression of AIF-1 in macrophages is critical for the activation of renal fibroblasts to a profibrotic phenotype. PMID: 29749461
- Macrophage-derived AIF-1 up-regulated reactive oxygen species production, adipokine TNFalpha, IL6, resistin release, and inhibited adiponectin secretion. PMID: 29788012
- A new subset of resident macrophages in the intestinal muscularis externa was discovered, identified as iba1(pos) CD169(neg). PMID: 27860408
- These results suggest that AIF-1 plays an important role in the mechanism underlying lung fibrosis, and may provide an attractive new therapeutic target. PMID: 29225172
- AIF-1 plays an important role in the mechanism underlying acute lung injury. PMID: 26911661
- These results imply daintain/AIF-1 triggers type 1 diabetes probably via arousing immune cells activation and induction of NO production in pancreas of NOD mice. PMID: 23022189
- AIF-1 was overexpressed in the liver of BALB/c mice infected with S. japonicum, and the interaction between AIF-1 and TNF-alpha or other cytokines played an important role in the pathogenesis and progression of hepatic schistosomiasis. PMID: 22150368
- Data suggest a strong association between AIF-1 expression, NF-kappaB activation, and development of experimental atherosclerosis. PMID: 21862018
- AIF-1 can induce IL-6 secretion on mononuclear cells and fibroblast chemotaxis. AIF-1 may accordingly provide an attractive new target for antifibrotic therapy in SSc as well as Scl GVHD. PMID: 21040744
- interferon gamma inducable and macrophage restricted expression requires Pu.1 PMID: 11861656
- This study demonstrated for the first time that allograft inflammatory factor-1(AIF-1) was expressed in uterus, and a correlation between AIF-1 production and fetal resorption in mice. PMID: 14506935
- These data indicate that AIF-1 mediates atherogenesis-initiated signaling and activation of macrophages. PMID: 16291819
- The molecular conformational change induced by Ca(2+)-binding of Iba1 is different from that found in the classical EF-hand proteins, which demonstrates that Iba1 has an unique molecular switching mechanism dependent on Ca(2+)-binding. PMID: 17011575
- AIF-1/Iba1 can be regarded a "pan-macrophage marker" because, except for alveolar macrophages, all subpopulations of macrophages examined express AIF-1/Iba1. PMID: 17874251
- allograft inflammatory factor 1 (AIF-1) expression results in increased signal transduction, neointimal formation, and vascular smooth muscle cell proliferation in injured mouse carotid arteries. PMID: 17991871
- These results suggest that enhanced AIF-1 expression leads to augmented incorporation of degenerated LDL by macrophages and promotes development of atherosclerotic vasculopathy. PMID: 18204784
- Iba1 was heavily expressed in the VM-M2, VM-M3 and RAW cells, but was mostly undetectable in the VM-NM1 cells and the AC cells. These findings support the microglial/macrophage origin of the metastatic VM-M2, VM-M3 tumor cells. PMID: 18398829
- AIF-1 is expressed in endothelial cells, macrophages and T cells in systemic sclerosis (SSc). PMID: 16868985