Recombinant Mouse Allograft Inflammatory Factor 1 (AIF1) Protein (hFc)

Name: Recombinant Mouse Allograft Inflammatory Factor 1 (AIF1) Protein (hFc)
Brand: Beta LifeScience
SKU: BLC-07117P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

The purity of Mouse Aif1 was greater than 90% as determined by SEC-HPLC

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Mouse Allograft Inflammatory Factor 1 (AIF1) Protein (hFc) is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE and HPLC.
Uniprotkb	O70200
Target Symbol	AIF1
Species	Mus musculus (Mouse)
Expression System	Mammalian cell
Tag	C-hFc
Target Protein Sequence	SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP
Expression Range	2-147aa
Protein Length	Full Length of Mature Protein
Mol. Weight	45.7 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
Subcellular Location	Cytoplasm, cytoskeleton. Cell projection, ruffle membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, phagocytic cup.
Database References	KEGG: mmu:11629 STRING: 10090.ENSMUSP00000025257 UniGene: Mm.10747
Tissue Specificity	Abundantly expressed in the testis, moderately in the spleen and lymph nodes and at low levels in the liver and thymus. Detected in macrophages.

Gene Functions References

Aif1 is important for bacterial and particle transcytosis in M cells. PMID: 28224999
These findings indicate that the expression of AIF-1 in macrophages is critical for the activation of renal fibroblasts to a profibrotic phenotype. PMID: 29749461
Macrophage-derived AIF-1 up-regulated reactive oxygen species production, adipokine TNFalpha, IL6, resistin release, and inhibited adiponectin secretion. PMID: 29788012
A new subset of resident macrophages in the intestinal muscularis externa was discovered, identified as iba1(pos) CD169(neg). PMID: 27860408
These results suggest that AIF-1 plays an important role in the mechanism underlying lung fibrosis, and may provide an attractive new therapeutic target. PMID: 29225172
AIF-1 plays an important role in the mechanism underlying acute lung injury. PMID: 26911661
These results imply daintain/AIF-1 triggers type 1 diabetes probably via arousing immune cells activation and induction of NO production in pancreas of NOD mice. PMID: 23022189
AIF-1 was overexpressed in the liver of BALB/c mice infected with S. japonicum, and the interaction between AIF-1 and TNF-alpha or other cytokines played an important role in the pathogenesis and progression of hepatic schistosomiasis. PMID: 22150368
Data suggest a strong association between AIF-1 expression, NF-kappaB activation, and development of experimental atherosclerosis. PMID: 21862018
AIF-1 can induce IL-6 secretion on mononuclear cells and fibroblast chemotaxis. AIF-1 may accordingly provide an attractive new target for antifibrotic therapy in SSc as well as Scl GVHD. PMID: 21040744
interferon gamma inducable and macrophage restricted expression requires Pu.1 PMID: 11861656
This study demonstrated for the first time that allograft inflammatory factor-1(AIF-1) was expressed in uterus, and a correlation between AIF-1 production and fetal resorption in mice. PMID: 14506935
These data indicate that AIF-1 mediates atherogenesis-initiated signaling and activation of macrophages. PMID: 16291819
The molecular conformational change induced by Ca(2+)-binding of Iba1 is different from that found in the classical EF-hand proteins, which demonstrates that Iba1 has an unique molecular switching mechanism dependent on Ca(2+)-binding. PMID: 17011575
AIF-1/Iba1 can be regarded a "pan-macrophage marker" because, except for alveolar macrophages, all subpopulations of macrophages examined express AIF-1/Iba1. PMID: 17874251
allograft inflammatory factor 1 (AIF-1) expression results in increased signal transduction, neointimal formation, and vascular smooth muscle cell proliferation in injured mouse carotid arteries. PMID: 17991871
These results suggest that enhanced AIF-1 expression leads to augmented incorporation of degenerated LDL by macrophages and promotes development of atherosclerotic vasculopathy. PMID: 18204784
Iba1 was heavily expressed in the VM-M2, VM-M3 and RAW cells, but was mostly undetectable in the VM-NM1 cells and the AC cells. These findings support the microglial/macrophage origin of the metastatic VM-M2, VM-M3 tumor cells. PMID: 18398829
AIF-1 is expressed in endothelial cells, macrophages and T cells in systemic sclerosis (SSc). PMID: 16868985

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.