Recombinant Mouse Adiponectin (ADIPOQ) Protein (His)

Name: Recombinant Mouse Adiponectin (ADIPOQ) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08385P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Mouse Adiponectin (ADIPOQ) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q60994
Target Symbol	ADIPOQ
Synonyms	Adipoq; Acdc; Acrp30; Apm1; Adiponectin; 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and collagen domain-containing protein; Adipocyte-specific protein AdipoQ
Species	Mus musculus (Mouse)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	KGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Expression Range	104-247aa
Protein Length	Partial
Mol. Weight	20.5 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Subcellular Location	Secreted.
Database References	KEGG: mmu:11450 STRING: 10090.ENSMUSP00000023593 UniGene: PMID: 28600493 Downregulation of adiponectin in inflamed adipocyte by fetuin-A through the mediation of Wnt3a and PPARgamma is a new report. PMID: 27720679 Study results indicate for the first time that adiponectin is able to influence the mechanical responses in strips from the mouse gastric fundus. PMID: 30254407 miR-711, which is upregulated by Adipoq, represses TLR4 signaling, acting therefore as a major mediator of the anti-inflammatory action of Adipoq. PMID: 28240307 both paracrine and endocrine effects of adiponectin may contribute to reduced reactive oxygen species generation and apoptosis after MI/R, in a CD36-dependent manner PMID: 29018142 These data may indicate that insulin resistance in Adp(-/-) mice is likely caused by an increase in concentrations of TNFalpha and FFA via downregulation of PPARalpha. PMID: 29445073 Adiponectin improves metabolic health but has only minor effects on reproductive functions in the polycystic ovary syndromemouse model. PMID: 28790184 APN attenuates adverse cardiac remodeling following cardiac injury by up-regulating MMP-9 expression. APN up-regulates MMP-9 expression via activation of AMPK and ERK1/2. PMID: 29263115 the effects of APN on the promotion of preadipocyte differentiation under inflammatory conditions may involve the PPARgamma signaling pathway, and at least partly depends on upregulation of PPARgamma expression. PMID: 29115433 Results demonstrate that adiponectin enhances inhibitory postsynaptic current onto neuropeptide Y (NPY) neurons to attenuate action potential firing in NPY neurons in a glucose-independent manner, being contrasted to its glucose-dependent effect on proopiomelanocortin neurons. PMID: 28606559 Results show a reciprocal regulation of adiponectin and FGF19 gene expression in mice. PMID: 27666676 Acrp30 (a globular form of adiponectin) reduces the expression of proinflammatory cytokines and the expression of RAGE as beta amyloid transporters into brain. Moreover, Acrp30 attenuated the apoptosis and the tight junction disruption through AdipoR1-mediated NF-kappaB pathway in beta amyloid-exposed bEnd.3 cells. PMID: 29022894 Findings demonstrate that adiponectin is an essential regulator of thermogenesis, and adiponectin is required for maintaining body temperature under cold exposure. PMID: 29058611 Chronic stress accelerates DPP4-mediated GLP-1 degradation and alters plasma adiponectin, accelerating vascular senescence and impairing ischemia-induced neovascularization. PMID: 28963101 AdipoQ antisense (AS) Long noncoding RNA (lncRNA) transfer from nucleus to cytoplasm inhibits adipogenesis through formation of an AdipoQ AS lncRNA/AdipoQ mRNA duplex to suppress the translation of AdipoQ mRNA.[ PMID: 29414510 Adiponectin enhances quiescence exit of murine hematopoietic stem cells and hematopoietic recovery through mTORC1 potentiation. PMID: 28480607 plasma adiponectin and leptin were also decreased in IL 10tm.These findings suggest that frailty observed in this mouse model of chronic inflammation may in part be driven by alterations in fat mass, hormone secretion and energy metabolism PMID: 29267271 CpG ODNs decreased placental adiponectin expression in NOD mice and impaired human trophoblast function and was associated with increased embryo loss. Adiponectin may therefore play an important protective role in the prevention of bacteria-induced pregnancy failure. PMID: 27094728 Caloric restriction (CR) impacted adiposity but only levels of the high molecular weight isoform of adiponectin responded to CR. PMID: 28156058 T-cadherin was essential for accumulation of adiponectin in the neointima and atherosclerotic plaque lesions, and the adiponectin-T-cadherin association protected against vascular injury. PMID: 28062540 mTORC1 mediated many of the beneficial actions of FGF21 in vitro, including UCP1 and FGF21 induction, increased adiponectin secretion, and enhanced glucose uptake without any adverse effects on insulin action. PMID: 27681418 AnxA6 protein in adipocytes was upregulated by oxidative stress which might trigger AnxA6 induction in adipose tissues and contribute to impaired fat storage and adiponectin release. PMID: 27702590 Adiponectin alters calcium and phosphate balance and renal mineral excretion, in part, through klotho. PMID: 27914707 Adiponectin (ApN) proves to be a powerful protector of the skeletal muscle capable of reversing the disease progression, thus making it a potential therapeutic agent for Duchenne muscular dystrophy (DMD). PMID: 28463682 These results demonstrated that LC along with insulin increases GSH levels thereby improving adiponectin secretion and glucose utilization in adipocytes. PMID: 28755973 Adiponectin, TNF-alpha, and LOX-1 exert complex regulatory effects on the coronary microvascular endothelial function in atherosclerotic ApoE knockout mice. PMID: 27050429 adiponectin inhibited endoplasmic reticulum stress and apoptosis of adipocyte in vivo and in vitro by activating the AMPK/PPARalpha/ATF2 pathway. PMID: 27882945 Irisin improved endothelial function by modulating HO-1/ adiponectin axis in perivascular adipose tissue (PVAT) in HFD-induced obese mice. These findings suggest that regulating PVAT function may be a potential mechanism by which irisin improves endothelial function in obesity. PMID: 28595178 a unique key feature of the T-cad prodomain is its involvement in binding of the T-cad repeats 1 and 2 to adiponectin; adiponectin positively regulates T-cad abundance PMID: 28325833 adiponectin maintains intestinal homeostasis and protects against murine colitis through interactions with its receptor AdipoR1 and by modulating adaptive immunity and STAT3 signaling PMID: 28258220 The KIF5B level was up-regulated during 3T3-L1 adipogenesis. This increase in cytosolic KIF5B was synchronized with the induction of adiponectin. Endogenous KIF5B and adiponectin were partially colocalized at the peri-nuclear and cytosolic regions. PMID: 27264953 The elevation in circulating levels of adiponectin and Fgf15 led to normalized hepatic and serum levels of bile acids, limited hepatic accumulation of toxic bile, attenuated inflammation, and amelioration of liver injury in the ethanol-fed mNT knockout mice. PMID: 27573244 Female adiponectin null mice displayed impaired fertility, reduced oocytes, disrupted estrous cycle, increased atretic follicles, and impaired late folliculogenesis. There was decrease in serum estradiol and FSH but an increase in LH and testosterone at proestrus. There was reduction of progesterone levels at diestrus, a significant decrease in LH receptor expression as well as in the number of GnRH immunoreactive neurons PMID: 27700136 Tongqiaohuoxue decoction improved obesity-induced inflammation and insulin resistance by increasing adiponectin production. PMID: 27404230 High salt is an important suppressor of cardioprotective APN and AdipoR1 in cardiac myocytes. PMID: 28051329 PPARdelta activation in perirenal fat by agonist or high sodium intake inhibited renal sodium-glucose cotransporter 2 (SGLT2) function, which is mediated by increased production of adipose adiponectin. PMID: 27053360 Acute knockdown of Insr or both Irs1 and Irs2 in adipocytes increased Adipoq mRNA expression but reduced adiponectin secretion. PMID: 26888756 Adiponectin may protect the aorta from atherosclerotic injury by reducing inflammation. Adiponectin effectively inhibits the activation of NF-kappa B pathway by inhibiting the expression of NF-kappa B nuclear protein p65. PMID: 26965176 Altered adiponectin multimerization could explain declined adiponectin levels and altered distribution of adiponectin complexes in the plasma of obese insulin-resistant individuals PMID: 26407855 The expression of PI3K-insensitive GSK3 stimulates the production of adiponectin and protects from diet-induced metabolic syndrome. PMID: 27140617 These data suggest that adiponectin could represent a possible biomarker in obesity-associated asthma PMID: 26462929 ADPN might act as a biomarker of inflammation and have potential for the treatment of hemorrhagic shock. PMID: 26909947 Adiponectin exerts novel effects to limit the production and action of mono-MPs, underscoring yet another pleiotropic effect of this adipokine. PMID: 26687997 The results demonstrated a dynamic dysfunction of APN/AdipoR1 axis accompanying progression of diabetes mellitus in mice with cerebral ischemia. PMID: 26611106 reduced plasma levels in obese mice treated with house dust mite allergens as compared to similarly treated lean mice PMID: 26476732 CRP decreased adiponectin expression and multimerization, while CRP-induced decline in adiponectin might be mediated through the PI3K/Akt pathway. PMID: 26812237 Globular Adiponectin (gAd) activates autophagy in myoblasts and gAd-activated autophagy drives the myogenic properties of this hormone. PMID: 26826036 APN can help to reduce periodontitis-related bone loss, modulate JMJD3 and IRF4 expression, and macrophage infiltration. PMID: 26399931 our data indicate that robust hypertrophic MEF2 activation in the heart in vivo requires a background of adiponectin signaling and that adiponectin signaling in primary isolated CM directly enhances MEF2 activity through activation of p38 MAPK PMID: 26196305 In 3T3-L1 adipocytes, catechin and quercetin attenuated TNF-alpha-induced elevated protein carbonyls, increased proinflammatory cytokine expression (MCP-1, resistin), and decreased adiponectin. PMID: 25620282

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.