Recombinant Mouse Acyl-Coa-Binding Protein (DBI) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-06827P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Mouse Acyl-Coa-Binding Protein (DBI) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-06827P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Mouse Acyl-Coa-Binding Protein (DBI) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P31786
Target Symbol DBI
Species Mus musculus (Mouse)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence MSQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFAQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI
Expression Range 1-87aa(K33A)
Protein Length Full Length
Mol. Weight 17.4 kDa
Research Area Metabolism
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Subcellular Location Endoplasmic reticulum. Golgi apparatus.
Protein Families ACBP family
Database References

KEGG: mmu:13167

STRING: 10090.ENSMUSP00000114705

UniGene: PMID: 28343864

  • ACBP increases the activity of ceramide synthase 2 (CerS2) by more than 2-fold and CerS3 activity by 7-fold. ACBP binds very-long-chain acyl-CoA esters, which is required for its ability to stimulate CerS activity. PMID: 28320857
  • Mice with conditional targeting of the Acbp gene in the epidermis recapitulate this phenotype, whereas generation of an artificial epidermal barrier during gland development reverses the phenotype PMID: 26142722
  • This study demonistrated that a novel role for ACBP in brain lipid metabolism. PMID: 25598214
  • Acyl-CoA binding protein and epidermal barrier function. [review] PMID: 24080521
  • ACBP is required for production of VLC-FFA for stratum corneum and for maintaining normal epidermal barrier function PMID: 22829653
  • It was concluded that acyl-CoA binding protein via aquaporin 3 is necessary for intact urine concentrating ability through efflux over the basolateral membrane of the collecting duct. PMID: 22237802
  • Diazepam binding inhibitor promotes progenitor proliferation in the postnatal SVZ by reducing GABA signaling. PMID: 22226357
  • lack of ACBP interferes with the normal metabolic adaptation to weaning and leads to delayed induction of the lipogenic gene program in the liver PMID: 21106527
  • Acyl-CoA binding protein gene ablation induces pre-implantation embryonic lethality in mice PMID: 20559753
  • Acute food deprivation reduces expression of diazepam-binding inhibitor in mouse glial cells. PMID: 20219854
  • the present study revealed a definite existence of DBI in non-neuronal supporting cells in both the central and peripheral nervous systems. PMID: 12002608
  • PPRE in intron 1 of the ACBP gene is a bona fide PPARgamma-response element. PMID: 12015306
  • A functionally active recombinant ACBP with amino acid sequence identical to the native protein interacts preferentially with anionic phospholipid-rich, highly curved membranes to facilitate transfer of ACBP-bound ligands. PMID: 12173941
  • ACBP was the most potent intracellular fatty acyl CoA binding protein in differentially modulating the activity of microsomal ACAT to form cholesteryl esters independent of cholesterol binding/transfer ability PMID: 12518025
  • Results identify new acyl-CoA binding protein transcripts in human and mouse tissues, generated by alternative first exon usage. PMID: 16055366
  • Acbp plays a role in triacylglycerol biosynthesis, and that regulation of this process is important for proper hair and skin development and maintenance in the mouse. PMID: 16902415
  • Endogenously overexpressed DBI impairs hippocampus-dependent learning without anxiety or proconflict behavior. PMID: 17150371
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed