Recombinant Mesocricetus Auratus Placenta-Expressed Transcript 1 Protein (PLET1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07651P
Greater than 90% as determined by SDS-PAGE.
Recombinant Mesocricetus Auratus Placenta-Expressed Transcript 1 Protein (PLET1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07651P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mesocricetus Auratus Placenta-Expressed Transcript 1 Protein (PLET1) Protein (His&Myc) is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q5W9T8 |
| Target Symbol | PLET1 |
| Synonyms | Antigen AgK114 |
| Species | Mesocricetus auratus (Golden hamster) |
| Expression System | Mammalian cell |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | ASYNDPCTVFDTISTTNLRVNITAEGSGENITYTVWVHVNSSVSVVILKAVNQDNKPVGTWVGATQECNDSSVLYRVTPSDNSDFQATWIVPNSEDITKVNLHVLMAIGNGTAAVTSVNLGEPQTSTPLRPTPEISETNQTTTMTTDKTPAMTTAKTPAMTTAKTTAKTTAKTTVKTTAMTTAKTTAKSLAVNALGS |
| Expression Range | 27-223aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 25.8 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle. |
| Subcellular Location | Apical cell membrane; Lipid-anchor, GPI-anchor. |
| Tissue Specificity | Present at high level in the dermal sheath cells near the bulge area of the hair follicle and in the differentiated sebocytes of the normal adult skin (at protein level). |
