Recombinant Mesocricetus Auratus Pancreatic Beta Cell Growth Factor (INGAP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01927P
Greater than 85% as determined by SDS-PAGE.
Recombinant Mesocricetus Auratus Pancreatic Beta Cell Growth Factor (INGAP) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01927P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Mesocricetus Auratus Pancreatic Beta Cell Growth Factor (INGAP) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q92778 |
| Target Symbol | INGAP |
| Synonyms | Islet neogenesis-associated protein |
| Species | Mesocricetus auratus (Golden hamster) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | EESQKKLPSSRITCPQGSVAYGSYCYSLILIPQTWSNAELSCQMHFSGHLAFLLSTGEITFVSSLVKNSLTAYQYIWIGLHDPSHGTLPNGSGWKWSSSNVLTFYNWERNPSIAADRGYCAVLSQKSGFQKWRDFNCENELPYICKFKV |
| Expression Range | 27-175aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 22.8 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Constituent of ilotropin, which is a partially purified preparation of cellophane wrapping (CW) pancreata. Capable of initiating duct cell proliferation, a prerequisite for islet neogenesis. |
| Subcellular Location | Secreted. |
| Tissue Specificity | Expressed only in CW animals pancreas and to a lesser extent in duodenum. In pancreas it is found in acinar cells, but not in islets. |
Gene Functions References
- data suggest that human adult pancreatic ductal cells retain morphogenetic plasticity and demonstrate that a short exposure to INGAP triggers their differentiation into insulin-expressing cells in vitro. PMID: 26558987
- The results indicate that endogenous INGAP plays a "physiological" positive modulatory role in insulin secretion, supporting its possible use in the treatment of prediabetes and Type 2 diabetes. PMID: 25160856
