Recombinant Mannheimia Haemolytica Leukotoxin (LKTA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04788P

Greater than 90% as determined by SDS-PAGE.
Recombinant Mannheimia Haemolytica Leukotoxin (LKTA) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04788P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Mannheimia Haemolytica Leukotoxin (LKTA) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P0C082 |
Target Symbol | LKTA |
Synonyms | lktALeukotoxin; Lkt |
Species | Mannheimia haemolytica (Pasteurella haemolytica) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | EEIIGTSHNDIFKGSQFNDAFNGGDGVDTIDGNGGNDRLFGGKGDDIIDGGDGDDFIDGGKGNDLLHGGRGDDIFVHRQGDGNDSITEAGGHDRLSFSDSNLKDLTFEKVNHHLVITNTKQEKVTIQNWFREEEFAKTVKNYVATRDEKIEEIIGQNGERITSKQVDELIAKGKDNKIDKNDLANVVNSYELLKNSRNVTNSLDKLISSVSSFTSSNDSRNVLATPTSMLDTSLSSLQFARAA |
Expression Range | 712-954aa |
Protein Length | Partial |
Mol. Weight | 33.9 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Pasteurella leukotoxins are exotoxins that attack host leukocytes and especially polymorphonuclear cells, by causing cell rupture. The leukotoxin binds to the host LFA-1 integrin and induces a signaling cascade leading to many biological effects, including tyrosine phosphorylation of the CD18 tail, elevation of the intracellular Ca(2+) and lysis of the host cell. This leukotoxin is a major contributor to the pathogenesis of lung injury in ovine pneumonic pasteurellosis. It has also weak hemolytic activity. |
Subcellular Location | Secreted. Host cell membrane; Multi-pass membrane protein. |
Protein Families | RTX prokaryotic toxin (TC 1.C.11) family |