Recombinant Loxosceles Amazonica Phospholipase D Lamsictox-Alphaic1 Protein (His)

Name: Recombinant Loxosceles Amazonica Phospholipase D Lamsictox-Alphaic1 Protein (His)
Brand: Beta LifeScience
SKU: BLC-09826P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Loxosceles Amazonica Phospholipase D Lamsictox-Alphaic1 Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	C0JAZ9
Target Symbol	C0JAZ9
Synonyms	Dermonecrotic toxin LamSicTox-alphaIC1; EC 4.6.1.-; Phospholipase D; PLD; Sphingomyelin phosphodiesterase D; SMD; SMase D; Sphingomyelinase D; Fragment
Species	Loxosceles amazonica (Recluse spider)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	WIMGHMVNNINQIEEFVSLGANSIETDVSFDKKANPEYTYHGTPCDCGRDCLRWEYFKDFLNGLRKATTPGDAKYREKLILVVFDLKTGSLYDNQAYDAGKSLAKNLLEYYWNNGNNGGRAYIVLSIPNLAHYKLVTGFKETLKDEGHEDLLEKVGHDFSGNDDIPDIESAYKKAGVTGHVWQSDGITNCLPRTLKRVILAIANRDSGSGIINKVYYWTVDKRSTTRDSLEAGVDGIMTNYPDVIADVLSEAAYKDKYRIATYDDNPWETFKA
Expression Range	1-273aa
Protein Length	Full Length
Mol. Weight	34.8kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Dermonecrotic toxins cleave the phosphodiester linkage between the phosphate and headgroup of certain phospholipids (sphingolipid and lysolipid substrates), forming an alcohol (often choline) and a cyclic phosphate. This toxin acts on sphingomyelin (SM). It may also act on ceramide phosphoethanolamine (CPE), lysophosphatidylcholine (LPC) and lysophosphatidylethanolamine (LPE), but not on lysophosphatidylserine (LPS), and lysophosphatidylglycerol (LPG). It acts by transphosphatidylation, releasing exclusively cyclic phosphate products as second products. Induces dermonecrosis, hemolysis, increased vascular permeability, edema, inflammatory response, and platelet aggregation.
Subcellular Location	Secreted.
Protein Families	Arthropod phospholipase D family, Class II subfamily
Tissue Specificity	Expressed by the venom gland.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.