Recombinant Leiurus Quinquestriatus Quinquestriatus Beta-Insect Excitatory Toxin Lqqit1 (TOXIN 1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11000P

Greater than 85% as determined by SDS-PAGE.
Recombinant Leiurus Quinquestriatus Quinquestriatus Beta-Insect Excitatory Toxin Lqqit1 (TOXIN 1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-11000P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Leiurus Quinquestriatus Quinquestriatus Beta-Insect Excitatory Toxin Lqqit1 (TOXIN 1) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P19856 |
Target Symbol | P19856 |
Synonyms | Beta-insect excitatory toxin LqqIT1; Insect toxin 1; LqqIT1' |
Species | Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN |
Expression Range | 1-70aa |
Protein Length | Full Length |
Mol. Weight | 11.7 |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Excitatory insect beta-toxins induce a spastic paralysis. They bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin induces a fast excitatory contraction paralysis on fly larvae. It is active only on insects. |
Subcellular Location | Secreted. |
Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily |
Tissue Specificity | Expressed by the venom gland. |