Recombinant Leiurus Quinquestriatus Hebraeus Alpha-Insect Toxin Lqhait Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02978P
Greater than 90% as determined by SDS-PAGE.
Recombinant Leiurus Quinquestriatus Hebraeus Alpha-Insect Toxin Lqhait Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-02978P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Leiurus Quinquestriatus Hebraeus Alpha-Insect Toxin Lqhait Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P17728 |
| Target Symbol | P17728 |
| Synonyms | Alpha-insect toxin LqhaIT; Lqh-alpha-IT; Alpha-IT |
| Species | Leiurus quinquestriatus hebraeus (Yellow scorpion) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK |
| Expression Range | 20-85aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 23.5kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice. |
| Subcellular Location | Secreted. |
| Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily |
| Tissue Specificity | Expressed by the venom gland. |
