Recombinant Leiurus Hebraeus Beta-Mammal/Insect Toxin Lqhb1 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-10944P
Greater than 85% as determined by SDS-PAGE.
Recombinant Leiurus Hebraeus Beta-Mammal/Insect Toxin Lqhb1 Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-10944P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Leiurus Hebraeus Beta-Mammal/Insect Toxin Lqhb1 Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P0C5H3 |
| Target Symbol | P0C5H3 |
| Synonyms | ; Beta-mammal/insect toxin Lqhb1; Lqh-beta-1 |
| Species | Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus) |
| Expression System | Baculovirus |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | DNGYLLNKATGCKVWCVINNASCNSECKLRRGNYGYCYFWKLACYCEGAPKSELWAYATNKCNGKL |
| Expression Range | 20-85aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 11.5 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. Competes, with apparent high affinity, with anti-insect and anti-mammalian beta-toxins for binding to cockroach and rat brain synaptosomes, respectively. Also competes with an anti-mammalian alpha-toxin on binding to rat brain sodium channels. Has a weak effect on cardiac sodium channels and a marked effect on rat brain and skeletal muscle sodium channels. |
| Subcellular Location | Secreted. |
| Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family |
| Tissue Specificity | Expressed by the venom gland. |
