Recombinant Lake Victoria Marburgvirus Polymerase Cofactor Vp35 (VP35) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00756P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Lake Victoria Marburgvirus Polymerase Cofactor Vp35 (VP35) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00756P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Lake Victoria Marburgvirus Polymerase Cofactor Vp35 (VP35) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P35259
Target Symbol VP35
Synonyms (Marburg VP35)(mVP35)
Species Lake Victoria marburgvirus (strain Musoke-80) (MARV) (Marburg virus (strain Kenya/Musoke/1980))
Expression System E.coli
Tag N-6His
Target Protein Sequence MWDSSYMQQVSEGLMTGKVPIDQVFGANPLEKLYKRRKPKGTVGLQCSPCLMSKATSTDDIIWDQLIVKRTLADLLIPINRQISDIQSTLSEVTTRVHEIERQLHEITPVLKMGRTLEAISKGMSEMLAKYDHLVISTGRTTAPAAAFDAYLNEHGVPPPQPAIFKDLGVAQQACSKGTMVKNATTDAADKMSKVLELSEETFSKPNLSAKDLALLLFTHLPGNNTPFHILAQVLSKIAYKSGKSGAFLDAFHQILSEGENAQAALTRLSRTFDAFLGVVPPVIRVKNFQTVPRPSQKSLRAVPPNPTIDKGWVCVYSSEQGETRALKI
Expression Range 1-329aa
Protein Length Full Length
Mol. Weight 40.2 kDa
Research Area Others
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling.
Subcellular Location Virion. Host cytoplasm.
Protein Families Filoviridae polymerase cofactor VP35 family
Database References

Gene Functions References

  1. In cell culture, Marburg virus infection results in a greater upregulation of IFN responses as compared to Ebolavirus infection, which correlates with differences in the efficiencies by which EBOV and MARV VP35s antagonize RIG-I signaling. PMID: 26876165
  2. Three important residues Arg271, Arg294, and Lys298 which makes the largest contribution for binding in VP35 lose their binding affinity significantly in mutants. PMID: 24459115
  3. Specific mutations in the IFN inhibitory domain (IID) of MARV VP35 that abrogate host immune responses. PMID: 25531184
  4. studies suggest VP35 can both coat the backbone and cap the ends of dsRNA, and that for MARV, coating of the dsRNA backbone may be an essential mechanism by which dsRNA is masked from backbone-sensing immune surveillance molecules PMID: 23028316
  5. The crystal structure of MARV VP35 IID in complex with 18-bp dsRNA reveals that despite the similar protein fold as EBOV VP35 IID, MARV VP35 IID interacts with the dsRNA backbone and not with blunt ends. PMID: 23185024

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from All Products
Tn5 Transposase
  • Expression system: E.coli;
CAT#: TN5-BL01
Sale
SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
  • Molecule: SHFL;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His+sumo;
  • Sequence: 1-291;
CAT#: BLT-08873P

Save $50
Sale
SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
  • Molecule: SFTPA1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His;
  • Sequence: 21-248;
CAT#: BLT-08790P

Save $50
Sale
SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
  • Molecule: SFTPA2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His;
  • Sequence: 21-248;
CAT#: BLT-08789P

Save $50
Sale
SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
  • Molecule: NDUFV1;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His+SUMO;
  • Sequence: 21-464aa;
CAT#: BLT-08321P

Save $50
Sale
SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
Human NEU2 (Sialidase-2) - Recombinant Protein
  • Molecule: NEU2;
  • Species: Human;
  • Expression system: E.coli;
  • Tag: N-6His;
  • Sequence: 1-380aa;
CAT#: BLT-08142P

Save $50
Recently viewed