Recombinant Lactobacillus Casei 60 Kda Chaperonin (GROEL) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00221P
Greater than 90% as determined by SDS-PAGE.
Recombinant Lactobacillus Casei 60 Kda Chaperonin (GROEL) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00221P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Lactobacillus Casei 60 Kda Chaperonin (GROEL) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Activity | Not tested. |
| Uniprotkb | B3W9W7 |
| Target Symbol | GROEL |
| Synonyms | (60 kDa chaperonin)(Chaperonin-60)(Cpn60) |
| Species | Lacticaseibacillus casei (strain BL23) (Lactobacillus casei) |
| Expression System | E.coli |
| Tag | C-6His |
| Target Protein Sequence | DTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDDPYILITDKKISNIQDILPLLQEIVQQGKALLIIADDVAGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAQLEDIATLTGGTVISSDLGLDLKDTKLEQLGRAGKVTVTKDNTTIVDGAGSKDAIAERVNIIKKQIDDTTSDFDREKLQERLAKLAGGV |
| Expression Range | 182-374aa |
| Protein Length | Partial |
| Mol. Weight | 27.9 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Together with its co-chaperonin GroES, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. |
| Subcellular Location | Cytoplasm. |
| Protein Families | Chaperonin (HSP60) family |
| Database References | KEGG: lcb:LCABL_24200 |
