Recombinant Jc Polyomavirus Small T Antigen (ST) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07126P
Greater than 85% as determined by SDS-PAGE.
Recombinant Jc Polyomavirus Small T Antigen (ST) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07126P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Jc Polyomavirus Small T Antigen (ST) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P03083 |
| Target Symbol | P03083 |
| Species | JC polyomavirus (JCPyV) (JCV) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MDKVLNREESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYKKMEQGVKVAHQPDFGTWNSSEVGCDFPPNSDTLYCKEWPNCATNPSVHCPCLMCMLKLRHRNRKFLRSSPLVWIDCYCFDCFRQWFGCDLTQEALHCWEKVLGDTPYRDLKL |
| Expression Range | 1-172aa |
| Protein Length | Full Length |
| Mol. Weight | 27.7 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Promotes efficient viral genome replication by modulating several host signaling pathways including transport network, interferon production or cell cycle progression. Inhibits host PP2A phosphatase activity and thereby prevents agnoprotein dephosphorylation. Inactivation of PP2A also results in the transactivation of cyclin A and cyclin D1 promoters. In addition, antagonizes the RIG-I/DDX58-mediated IFN response through interaction with E3 ligase TRIM25 leading to the inhibition of 'Lys-63'-linked ubiquitination of DDX58. Inhibits nucleotide excision repair (NER) pathway which leads to DNA strand breaks during DNA replication and micronuclei formation. |
| Subcellular Location | Host cytoplasm. Host nucleus. |
| Database References | KEGG: vg:1489521 |
Gene Functions References
- JC virus tAg contributes significantly to viral DNA replication in vivo; binds Rb proteins and PP2A. PMID: 20485545
