Recombinant Influenza A Virus Protein Pb1-F2 (PB1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00667P
Greater than 85% as determined by SDS-PAGE.
Recombinant Influenza A Virus Protein Pb1-F2 (PB1) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-00667P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Influenza A Virus Protein Pb1-F2 (PB1) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P0C5V3 |
| Target Symbol | PB1 |
| Species | Influenza A virus (strain A/Silky Chicken/Hong Kong/YU100/2002 H5N1 genotype X3) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | MEQEQDTPWTRSIEHINTQRRGNGQQTQKLEHPNSIQLMDHYPRITSRADMHKQIVCWKQWLSLKNPTQGSLKTHVLKRWKLFSKQEWTN |
| Expression Range | 1-90aa |
| Protein Length | Full Length |
| Mol. Weight | 18.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays an important role in promoting lung pathology in both primary viral infection and secondary bacterial infection. Promotes alteration of mitochondrial morphology, dissipation of mitochondrial membrane potential, and cell death. Alternatively, inhibits the production of interferon in the infected cell at the level of host mitochondrial antiviral signaling MAVS. Its level of expression differs greatly depending on which cell type is infected, in a manner that is independent of the levels of expression of other viral proteins. Monocytic cells are more affected than epithelial cells. Seems to disable virus-infected monocytes or other host innate immune cells. During early stage of infection, predisposes the mitochondria to permeability transition through interaction with host SLC25A6/ANT3 and VDAC1. These proteins participate in the formation of the permeability transition pore complex (PTPC) responsible of the release of mitochondrial products that triggers apoptosis. |
| Subcellular Location | Host mitochondrion inner membrane. Host nucleus. Host cytoplasm, host cytosol. |
| Protein Families | Influenza viruses PB1-F2 family |
