Recombinant Influenza A Virus Matrix Protein 2 (M) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07941P
Greater than 90% as determined by SDS-PAGE.
Recombinant Influenza A Virus Matrix Protein 2 (M) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07941P
Collections: All products, Featured viral antigens molecules, High-quality recombinant proteins, Influenza a/b antigen, Influenza hemagglutinin (ha) protein: target overview, research applications, and selection guide, Recombinant proteins fall special offers - full-length proteins, Recombinant transmembrane proteins, Viral antigen recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Influenza A Virus Matrix Protein 2 (M) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P06821 |
| Target Symbol | M |
| Synonyms | (Proton channel protein M2) |
| Species | Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) |
| Expression System | in vitro E.coli expression system |
| Tag | N-10His |
| Target Protein Sequence | MSLLTEVETPIRNEWGCRCNGSSDPLAIAANIIGILHLILWILDRLFFKCIYRRFKYGLKGGPSTEGVPKSMREEYRKEQQSAVDADDGHFVSIELE |
| Expression Range | 1-97aa |
| Protein Length | Full Length |
| Mol. Weight | 12.5 kDa |
| Research Area | Tags & Cell Markers |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry. After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation. |
| Subcellular Location | Virion membrane. Host apical cell membrane; Single-pass type III membrane protein. |
| Protein Families | Influenza viruses matrix protein M2 family |
| Database References | KEGG: vg:956528 |
Gene Functions References
- The data demonstrated that immunization with recombinant L. plantarum expressing 3M2e-Fc markedly reduced the viral load in the lung and protected against H1N1 influenza virus and mouse-adapted H9N2 avian influenza virus (AIV) challenge in BALB/c mice [M2e]. PMID: 27908830
- this work shows the production and isolation of a tetrameric and functional native M2 ion channel that will pave the way to structural and functional characterization of native M2, conformational antibody development, small molecules compounds screening towards vaccine treatment. PMID: 27825980
- BST-2 restricts influenza A virus release and is countered by the viral M2 protein. PMID: 28087685
- Host cellular protein TRAPPC6ADelta interacts with influenza A virus M2 protein and regulates viral propagation by modulating M2 trafficking. PMID: 27795429
- M2 protein is translocated from the membrane to the cytoplasm by a retrograde route via endosomes and the Golgi network. PMID: 27942972
- Studied the structure of the C-terminal juxtamembrane region (sites 50-60) of the full-length M2 protein using site-directed spin-labeling electron paramagnetic resonance (EPR) spectroscopy in lipid bilayers. PMID: 25545360
- The tautomeric state and conformation of His37, a key residue in the M2 transmembrane four-helix bundle, controls the gating of the channel. PMID: 25317959
- Results indicate that Fc receptors play a primary role in conferring M2e-specific antibody-mediated protection whereas T cells may contribute to the recovery at later stages of influenza infection. PMID: 24773389
- Authors show that the cytoplasmic tail of influenza A virus M2 interacts directly with the essential autophagy protein LC3 and promotes LC3 relocalization to the unexpected destination of the plasma membrane. PMID: 24528869
- Clustering between hemagglutinin (HA) and M2 is reduced upon disruption of HA's raft-association features (acylation, transmembranous VIL motif). PMID: 24561202
- NS1,hemagglutinin and M2 are involved in stimulation of autophagy in infected cells. PMID: 24027311
- Data suggest that solubilization of M2 construct into bicelles results in an increased ordering of the TMH-APH (transmembrane helix- amphipathic helix) linker resulting in a more fixed orientation between the TMH and APH. PMID: 24168642
- Data show that that the M2 proton channel is properly targeted to cell membranes in Drosophila tissues and functions as a proton channel by altering intracellular pH. PMID: 21775472
- Data show that M2 acts as a proton uniporter that occasionally allows K(+) to flow to maintain electrical neutrality. PMID: 20713739
- the M2 cytoplasmic tail plays a role in infectious virus production by coordinating the efficient packaging of genome segments into influenza virus particles. PMID: 15731254
- These results indicated that the M2 ion-channel protein is critical, but not essential, for virus replication in cell culture. PMID: 15831957
- results demonstrate that a dramatic reduction in the levels of the M1 and M2 proteins in influenza A virus-infected cells results in reduced virus replication but does not significantly affect the composition and morphology of the virus particles PMID: 15919950
- To better understand its H+ gating mechanism, we investigated M2 in lipid bilayers with a new combination of IR spectroscopies and theory. PMID: 19217395
- Influenza A virus infection causes accumulation of autophagosomes by blocking their fusion with lysosomes, and one viral protein, matrix protein 2, is necessary and sufficient for this inhibition of autophagosome degradation. PMID: 19837376
