Recombinant Infectious Bronchitis Virus Spike Glycoprotein S1 Subunit (S1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-06091P

Greater than 90% as determined by SDS-PAGE.
Recombinant Infectious Bronchitis Virus Spike Glycoprotein S1 Subunit (S1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-06091P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Infectious Bronchitis Virus Spike Glycoprotein S1 Subunit (S1) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | D9IAI3 |
Target Symbol | S1 |
Species | Infectious bronchitis virus |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | ACQYNTGNFSDGFYPFTNVSLVKERFVVYRETSVNTTLVLTNFTFTNVSNASPNTGGVNTINIYQTQTAQSGYYNFNFSFLSSFVYKQSDFMYGSYHPKCDFRPETINNGLWFNSLSVSLAYGPLQGGCKQSVFSNRATCCYAYSYNGPRLCKGVYIGELPQYFECGLLVYVIKSDGSRIQTRNEPLVLTHYNYNNITLDRCVEYNIYGRSGQGFIINVTASAANYNYLADGGLAILDTSGAIDIFVVQGEYGPNYYKVNPCEDVNQQFVVSGGGIVGVLTSHNETGSQQLENRFYVKLTNSTRRTRRL |
Expression Range | 231-539aa |
Protein Length | Partial |
Mol. Weight | 61.7kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |