Recombinant Hydrophis Schistosus Basic Phospholipase A2 (SVPLA2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07472P

Greater than 85% as determined by SDS-PAGE.
Recombinant Hydrophis Schistosus Basic Phospholipase A2 (SVPLA2) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-07472P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Hydrophis Schistosus Basic Phospholipase A2 (SVPLA2) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P00610 |
Target Symbol | P00610 |
Species | Hydrophis schistosus (Beaked sea snake) (Enhydrina schistosa) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | NLVQFSYVITCANHNRRSSLDYADYGCYCGAGGSGTPVDELDRCCKIHDDCYGEAEKQGCYPKMLMYDYYCGSNGPYCRNVKKKCNRKVCDCDVAAAECFARNAYNNANYNIDTKKRCK |
Expression Range | 1-119aa |
Protein Length | Full Length |
Mol. Weight | 20.9 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Snake venom phospholipase A2 (PLA2) that has several activities. It is myotoxic, has weak anticoagulant activity and inhibits neuromuscular transmission by blocking acetylcholine release from the nerve termini. PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. |
Subcellular Location | Secreted. |
Protein Families | Phospholipase A2 family, Group I subfamily, D49 sub-subfamily |
Tissue Specificity | Expressed by the venom gland. |