Recombinant Human Zymogen Granule Protein 16 Homolog B (ZG16B) Protein (His), Active

Name: Recombinant Human Zymogen Granule Protein 16 Homolog B (ZG16B) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05750P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/ml can bind Anti-ZG16B recombinant antibody , the EC 50 is 24.13-46.04 ng/mL. Biological Activity Assay

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Zymogen Granule Protein 16 Homolog B (ZG16B) Protein (His), Active is produced by our Mammalian cell expression system. This is a full length protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized Human ZG16B at 2 μg/mL can bind Anti-ZG16B recombinant antibody , the EC 50 is 24.13-46.04 ng/mL.
Uniprotkb	Q96DA0
Target Symbol	ZG16B
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-10His
Target Protein Sequence	GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Expression Range	53-208aa
Protein Length	Full Length of Mature Protein
Mol. Weight	20.0 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Secreted.
Protein Families	Jacalin lectin family
Database References	HGNC: 30456 KEGG: hsa:124220 STRING: 9606.ENSP00000371715 UniGene: PMID: 27322081 Mouse DCPP1 is a multifunctional promoter of tumor growth through functional activation of pancreatic cancer cells, suggesting it to be an ortholog of human PAUF. PMID: 28988106 Our results suggest that PAUF has tumour-promoting functions in oral squamous cell carcinoma PMID: 27706833 High PAUF expression is associated with resistance to gemcitabine in pancreatic cancer. PMID: 26684804 PAUF mediated dendritic cell activation and immune stimulation are dependent on TLR4 PMID: 26336989 constitutive suppression of PAUF sensitized Bxpc3 pancreatic cancer cells to oncolytic parvovirus H-1 infection PMID: 25727013 PAUF rs12373A>C polymorphisms are associated with colorectal cancer. PMID: 25079514 PAUF-siRNA inhibited the proliferation of colorectal cancer cells, promoted their apoptosis and induced G0/G1 cell cycle arrest. At the same time, PAUF-siRNA inhibited the invasion, adhesion and migration of the tumor cells. PMID: 23677445 new possibilities for PAUF's role in the pathogenesis of angiogenesis-dependent diseases PMID: 22907431 activation of SIRT1 inhibited the proliferation of pancreatic cancer -PAUF cells by down-regulation of cyclin-D1, a target molecule of beta-catenin. PMID: 22640743 PAUF-mediated FAK activation plays an important role in pancreatic cancer progression. PMID: 21464589 PAUF can up-regulate and stabilize beta-catenin via a novel pattern of phosphorylation, thereby contributing to the rapid proliferation of pancreatic cancer cells. PMID: 21196815 Data demonstrate that the host salivary protein CSP-1 (HRPE773 GenBank AAQ89380.1) binds to S. mutans cells and may influence the initial colonization of this pathogenic bacterium onto the tooth surface. PMID: 20858015 the sugar-binding site and the adjacent basic patch of ZG16p and ZG16b cooperatively form a functional glycosaminoglycan-binding site. PMID: 21110947 PAUF is a mammalian lectin normally found in plant lectins. PAUF induces extracellular signal-regulated kinase phosphorylation and activates the IKK-b-mediated TPL2/MEK/ERK signaling pathway through TLR2. PMID: 20802527 Findings indicate that PAUF enhances the metastatic potential of pancreatic cancer cells, at least in part, by upregulating CXCR4 expression. PMID: 19784070 Bioinformatic analysis identified a putative human CSP-1/Dcpp ortholog, HRPE773, expressed predominantly in human salivary tissue, that shows 31% amino acid identity and 45% amino acid similarity to the mouse Dcpp query sequence. PMID: 16954406 pancreatic adenocarcinoma up-regulated factor was secreted into the culture medium of pancreatic adenocarcinoma up-regulated factor-overexpressing Chinese hamster ovary cells, had an apparent molecular mass of approximately 25 kDa, and was N-glycosylated PMID: 19302292

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.