Recombinant Human Zinc Transporter Zip11 (SLC39A11) Protein (His-GST)
Beta LifeScience
SKU/CAT #: BLC-07193P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Zinc Transporter Zip11 (SLC39A11) Protein (His-GST)
Beta LifeScience
SKU/CAT #: BLC-07193P
Regular price
$54900
$549.00
Sale price$9900
$99.00Save $450
/
Product Overview
Description | Recombinant Human Zinc Transporter Zip11 (SLC39A11) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q8N1S5 |
Target Symbol | SLC39A11 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-GST |
Target Protein Sequence | YLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRR |
Expression Range | 93-193aa |
Protein Length | Partial |
Mol. Weight | 42.2 kDa |
Research Area | Metabolism |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Functions as a cellular zinc transporter. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. Nucleus. Cytoplasm. Golgi apparatus. |
Protein Families | ZIP transporter (TC 2.A.5) family |
Database References |
Gene Functions References
- Polymorphisms within ZIP11 gene were significantly associated with bladder cancer risk. PMID: 25900876
- In glioma tumors, low ZIP11 expression was significantly associated with higher grade. Higher ZIP11 expression was weakly correlated with IDH1 mutation status. PMID: 25921144
- This paper describes the genomic region surrounding the SOX9 gene which includes SLC39A11 (C17orf26). PMID: 11707075