Recombinant Human Zinc Transporter 10 (SLC30A10) Protein (His&Myc)
Recombinant Human Zinc Transporter 10 (SLC30A10) Protein (His&Myc)
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Zinc Transporter 10 (SLC30A10) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q6XR72 |
| Target Symbol | SLC30A10 |
| Synonyms | (ZnT-10)(Manganese transporter SLC30A10)(Solute carrier family 30 member 10) |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | KETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQDASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGALPLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYVNRTHF |
| Expression Range | 300-485aa |
| Protein Length | Partial |
| Mol. Weight | 27.9 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays a pivotal role in manganese transport. Manganese is an essential cation for the function of several enzymes, including some crucially important for the metabolism of neurotransmitters and other neuronal metabolic pathways. However, elevated levels of manganese are cytotoxic and induce oxidative stress, mitochondrial dysfunction and apoptosis. Acts as manganese efflux transporter and confers protection against manganese-induced cell death. Also acts as zinc transporter involved in zinc homeostasis. Seems to mediate zinc transport into early endosomes and recycling endosomes to prevent zinc toxicity; the function may be regulated by heterodimerization with other zinc transporters of the SLC30A subfamily. The SLC30A3:SLC30A10 heterodimer is involved in zinc transport-dependent regulation of the EGFR/ERK transduction pathway in endosomes. May be involved in regulation of zinc-dependent senescence of vascular smooth muscle cells. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network. Recycling endosome. Early endosome. |
| Protein Families | Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily |
| Database References | HGNC: 25355 OMIM: 611146 KEGG: hsa:55532 STRING: 9606.ENSP00000355893 UniGene: PMID: 27550551 |
