Recombinant Human Zinc Finger Protein Gli2 (GLI2) Protein (His-SUMO)

Name: Recombinant Human Zinc Finger Protein Gli2 (GLI2) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09300P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Zinc Finger Protein Gli2 (GLI2) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P10070
Target Symbol	GLI2
Synonyms	CJS; Gli 2; GLI family zinc finger 2; GLI Kruppel family member GLI2; GLI2; GLI2_HUMAN; Glioma associated oncogene family zinc finger; HPE9; Oncogene GLI2; PHS2; Tax helper protein 1; Tax helper protein 2; Tax helper protein; Tax responsive element 2 holding protein; Tax responsive element 25 bp sequence binding protein; THP; THP1; THP2; Zinc finger protein GLI2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL
Expression Range	412-641aa
Protein Length	Partial
Mol. Weight	42.5kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Functions as transcription regulator in the hedgehog (Hh) pathway. Functions as transcriptional activator. May also function as transcriptional repressor. Requires STK36 for full transcriptional activator activity. Required for normal embryonic development.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Acts as a transcriptional activator in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; Acts as a transcriptional repressor.
Subcellular Location	Nucleus. Cytoplasm. Cell projection, cilium.; [Isoform 1]: Nucleus.; [Isoform 2]: Nucleus.
Protein Families	GLI C2H2-type zinc-finger protein family
Database References	HGNC: 4318 OMIM: 165230 KEGG: hsa:2736 STRING: 9606.ENSP00000354586 UniGene: Hs.111867
Associated Diseases	Holoprosencephaly 9 (HPE9); Culler-Jones syndrome (CJS)
Tissue Specificity	Expressed in breast cancers (at protein level). Isoform 1 and isoform 4 are expressed in HTLV-1-infected T-cell lines (at protein level). Isoform 1 and isoform 2 are strongly expressed in HTLV-1-infected T-cell lines. Isoform 3 and isoform 4 are weakly ex

Gene Functions References

Importantly, high expression levels of HIF-1alpha/TGF-beta2/GLI2 correlated robustly with the patient relapse following chemotherapy, highlighting a potential biomarker and therapeutic target for chemoresistance in colorectal cancer. PMID: 29891662
Study found increased expression of GLI2 in osteosarcoma tissues and cell lines and determined that GLI2 is a target of miR-141-3p. PMID: 29251328
In conclusion, our data suggest that overexpression of the Hedgehog components SHH, GLI2 and FOXA2 might be used as markers of an aggressive hemangioma. PMID: 28370639
High GLI2 or PDGFRB expression is associated with unfavorable survival in GC patients. GLI2 can induce PDGFRB expression in GC cells via directly binding to its promoter. In addition, the GLI2-PDGFRB axis might be an important signaling pathway modulating CSC properties of GC cells. PMID: 28975979
Study report that compromised CSL function depends on GLI activation for conversion of human dermal fibroblasts into CAFs, separately from cellular senescence. Decreased CSL upregulates the expression of the ULK3 kinase, which binds and activates GLI2. PMID: 28877478
The authors found that hepatitis C virus derived from hepatitis C patients infected and directly induced the trans-differentiation of human primary fibroblasts into myofibroblasts, promoting fibrogenesis. This effect correlated with the activation of GLI2, one of the targets of Hedgehog signaling pathway previously reported to be involved in myofibroblast generation. PMID: 27476557
role of GLI2-ABCG2 signaling axis for 5Fu resistance in gastric cancer PMID: 28847472
This study showed associations of anorectal malformations with rs3738880 in GLI2 and with previous miscarriages. PMID: 28057877
High GLI2 expression is associated with hepatocellular carcinoma. PMID: 27036048
our findings demonstrate that multiple signaling pathways converge on Gli2 to mediate PTHrP expression and bony invasion, highlighting Gli2 as a therapeutic target to prevent bony invasion in OSCC. PMID: 27738315
the effect gene of the Shh pathway, gli1, was found to have a reduced level of expression along with a decreased expression of gli2. PMID: 26446020
High Gli2 expression is associated with non-small cell lung cancer. PMID: 26936993
GLI2 is a dosage-sensitive gene that may be responsible for the agenesis of corpus callosum observed in the proband. PMID: 27346851
Data suggest that Nrp1 (neuropilin-1) regulates Hedgehog signaling specifically at the level of activation of GLI2 transcriptional activator function; Nrp1 localization to primary cilium does not correlate with Hedgehog signal promotion. These studies were conducted in various cell types. PMID: 28667171
studies identify a novel molecular mechanism of regulation of CD40L by the transcription factor GLI2 in the tumor microenvironment downstream of CCR3 signaling PMID: 28461568
the data suggest that CCRK positively regulates the kinetics by which ciliary proteins such as Smoothened and Gli2 are imported into the cilium, and that the efficiency of ciliary recruitment allows for potent responses to Hedgehog signaling over long time periods. PMID: 28817564
GLI2 is a regulator of beta-catenin and provides insights into its role in tumorigenesis. PMID: 28300597
bioinformatics analysis and luciferase reporter assay predicted the direct binding to miR-125b-5p, which has been reported to function as a tumor suppressor in osteosarcoma. Furthermore, functional experiments validated that cir-GLI2 exerted the tumor-promoting effects on osteosarcoma cells via negatively targeting miR-125b-5p. PMID: 28695772
These results demonstrate that miR-124 is an important downstream target gene of Hh signaling, and the Gli2/miR-124/AURKA axis is essential for the proliferation and growth of human glioma cells. PMID: 28393219
in trophoblasts, GLI2 not only directly bound to the promoter region of gene hsd11b2 to transactivate hsd11b2 but also formed a heterodimer with RNA polymerase II, resulting in up-regulation of hsd11b2 gene transcription PMID: 27379371
GLI2 was identified as a crucial downstream mediator of the pro-fibrotic effects of TGF-beta. PMID: 27793816
this study shows that Gli2 expression was more often positive in advanced non-small-cell lung carcinoma patients refractory to platinum-based chemotherapy PMID: 26762562
Beclin-1 acts as a tumor suppressor by regulating the hedgehog (HH) signaling pathway through Gli2 expression in gastric adenocarcinoma. PMID: 25512258
Overexpression of GLI2 is associated with osteosarcoma progression. PMID: 27460090
MALAT1 promotes gastric cancer proliferation and progression. MALAT1 is a direct target of miR-202 and knockdown of MALAT1 significantly decreases the expression of Gli2 by negatively regulating miR-202. PMID: 27887846
the GLI2 gene may be one of the candidate genes to analyze when an association of pituitary hormone deficiency and developmental defects in posterior pituitary gland. The highly variable phenotype found suggests the presence of additional unknown factors that could contribute to the phenotype observed in these patients. PMID: 27576279
the GLI2 protein level could serve as a feasible marker of ligand-dependent hedgehog activation in pancreatic neoplasms. PMID: 27543868
ALDH1A1 stabilizes the Gli2 protein in an enzyme-independent manner in hepatocellular cancer. PMID: 26896768
GLI2 stabilized glial cell missing-a, a pivotal transcriptional factor for trophoblastic syncytialization. PMID: 26769961
The results do not support our hypothesis that common germline genetic variants in the GLI2 genes is associated with the risk of developing medulloblastoma. PMID: 26290144
GLI2 mutations typically result in pituitary anomalies with or without postaxial polydactyly. PMID: 25974718
Serum starvation significantly up-regulated the expression of Gli1, which in turn increased its key target cIAP2 expression and enhanced NF-kappaB/cIAP2 pathway, resulting in promoting cell survival under serum starvation PMID: 26182949
the JQ1-resistant cells remain dependent on c-MYC that now becomes co-regulated by high levels of GLI2 PMID: 25807524
A relatively high frequency of GLI2 mutations occur in patients with congenital growth hormone deficiency. [Review] PMID: 25878059
hsa-miR-665 and hsa-miR-95 were downregulated in GSRCC but upregulated in intestinal gastric adenocarcinoma, and the relatively differential expression of the miRNAs negatively controlling their target genes, GLI2 and PLCG1 PMID: 25964059
during vertebrate history GLI2 acquired a high level of complexity in the genetic mechanisms regulating its expression during spatiotemporal patterning of the central nervous system (CNS) and limbs. PMID: 25715918
This family confirms the incomplete penetrance of genomic disturbances affecting the GLI2 gene. However, the family presented here is unique as none of the three identified individuals with a GLI2 deletion showed any typical signs of holoprosencephaly PMID: 25820550
We genotyped the SLC6A4 5-HTTLPR (rs4795541, rs25531) and TPH2 1125A>T (rs4290270) variants and evaluated their role in moderating disulfiram treatment for cocaine dependence. PMID: 22925276
miR-218 and its downstream target Gli2, as well as E-cadherin, participate in the anti-invasion process PMID: 25694126
GLI2 forms part of a core HH pathway transcriptional regulatory network that promotes human myeloid leukemic progression and dormant LSC generation PMID: 25889765
SPOP plays critical roles in suppressing gastric tumorigenesis through inhibiting Hh/Gli2 signaling pathway. It may provide an alternative strategy for developing therapeutic agents of gastric cancer in future. PMID: 25204354
Gli2 silencing enhances TRAIL-induced apoptosis and reduces tumor growth in human hepatoma cells in vivo. PMID: 25535898
results indicate that miR-202 acts as a novel tumor suppressor to regulate OS cell proliferation and apoptosis through downregulating Gli2 expression. PMID: 25156120
GLI2 regulated metastasis as well as the progression of osteosarcomas. PMID: 25082385
The 14-3-3zeta-driven contextual changes of Smad partners from p53 to Gli2 may serve as biomarkers and therapeutic targets of TGF-beta-mediated cancer progression PMID: 25670079
Report shows that GLI2 is the novel target gene of DeltaNp63alpha and that DeltaNp63alpha-GLI2 crosstalk in osteosarcoma cells is a necessary event in osteosarcoma progression. PMID: 25085524
Increased GLI2 expression is associated with osteosarcoma invasion. PMID: 25449781
Individuals with truncating mutations in GLI2 typically present with pituitary anomalies, polydactyly and subtle facial features rather than holoprosencephaly PMID: 24744436
High Gli2 expression is associated with bone destruction in lung and breast cancer. PMID: 25359619
Our studies demonstrate an important role for GLI2 in Lung squamous cell carcinoma PMID: 24423612

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.