Recombinant Human Zinc Finger Protein Gli2 (GLI2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10888P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Zinc Finger Protein Gli2 (GLI2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10888P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Zinc Finger Protein Gli2 (GLI2) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P10070 |
| Target Symbol | GLI2 |
| Synonyms | CJS; Gli 2; GLI family zinc finger 2; GLI Kruppel family member GLI2; GLI2; GLI2_HUMAN; Glioma associated oncogene family zinc finger; HPE9; Oncogene GLI2; PHS2; Tax helper protein 1; Tax helper protein 2; Tax helper protein; Tax responsive element 2 holding protein; Tax responsive element 25 bp sequence binding protein; THP; THP1; THP2; Zinc finger protein GLI2 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL |
| Expression Range | 412-641aa |
| Protein Length | Partial |
| Mol. Weight | 28.5kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Functions as transcription regulator in the hedgehog (Hh) pathway. Functions as transcriptional activator. May also function as transcriptional repressor. Requires STK36 for full transcriptional activator activity. Required for normal embryonic development.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Involved in the smoothened (SHH) signaling pathway.; Acts as a transcriptional activator in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; (Microbial infection) Acts as a transcriptional activators in T-cell leukemia virus type 1 (HTLV-1)-infected cells in a Tax-dependent manner. Binds to the DNA sequence 5'-GAACCACCCA-3' which is part of the Tax-responsive element (TRE-2S) regulatory element that augments the Tax-dependent enhancer of HTLV-1.; Acts as a transcriptional repressor. |
| Subcellular Location | Nucleus. Cytoplasm. Cell projection, cilium.; [Isoform 1]: Nucleus.; [Isoform 2]: Nucleus. |
| Protein Families | GLI C2H2-type zinc-finger protein family |
| Database References | HGNC: 4318 OMIM: 165230 KEGG: hsa:2736 STRING: 9606.ENSP00000354586 UniGene: PMID: 29891662 |
