Recombinant Human Zinc Finger Protein Gli1 (GLI1) Protein (His&His)
Beta LifeScience
SKU/CAT #: BLC-01245P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Zinc Finger Protein Gli1 (GLI1) Protein (His&His)
Beta LifeScience
SKU/CAT #: BLC-01245P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Zinc Finger Protein Gli1 (GLI1) Protein (His&His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P08151 |
| Target Symbol | GLI1 |
| Synonyms | (Glioma-associated oncogene)(Oncogene GLI) |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His&C-6His |
| Target Protein Sequence | SPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGD |
| Expression Range | 201-400aa |
| Protein Length | Partial |
| Mol. Weight | 28.3 kDa |
| Research Area | Developmental Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acts as a transcriptional activator. Binds to the DNA consensus sequence 5'-GACCACCCA-3'. Regulates the transcription of specific genes during normal development. Plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling. Plays a role in cell proliferation and differentiation via its role in SHH signaling.; Acts as a transcriptional activator, but activates a different set of genes than isoform 1. Activates expression of CD24, unlike isoform 1. Mediates SHH signaling. Promotes cancer cell migration. |
| Subcellular Location | Cytoplasm. Nucleus.; [Isoform 2]: Cytoplasm. Nucleus. |
| Protein Families | GLI C2H2-type zinc-finger protein family |
| Database References | HGNC: 4317 OMIM: 165220 KEGG: hsa:2735 STRING: 9606.ENSP00000228682 UniGene: PMID: 29321573 |
