Recombinant Human Yjef N-Terminal Domain-Containing Protein 3 (YJEFN3)
Beta LifeScience
SKU/CAT #: BLC-04912P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Yjef N-Terminal Domain-Containing Protein 3 (YJEFN3)
Beta LifeScience
SKU/CAT #: BLC-04912P
Regular price
$70700
$707.00
Sale price$24000
$240.00Save $467
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Yjef N-Terminal Domain-Containing Protein 3 (YJEFN3) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | A6XGL0 |
| Target Symbol | YJEFN3 |
| Synonyms | YJEFN3; YjeF N-terminal domain-containing protein 3; YjeF_N3; hYjeF_N3 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Target Protein Sequence | MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL |
| Expression Range | 1-299aa |
| Protein Length | Full Length |
| Mol. Weight | 32.6 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May accelerate cholesterol efflux from endothelial cells to high-density lipoprotein (HDL) and thereby regulates angiogenesis. May orchestrate hematopoietic stem and progenitor cell emergence from the hemogenic endothelium, a type of specialized endothelium manifesting hematopoietic potential. YJEFN3-mediated cholesterol efflux activates endothelial SREBF2, the master transcription factor for cholesterol biosynthesis, which in turn transactivates NOTCH and promotes hematopoietic stem and progenitor cell emergence. May play a role in spermiogenesis and oogenesis. |
| Database References | |
| Tissue Specificity | Expressed in theca cells in ovary and in Leydig cells in testis (at protein level). Also expressed in brain and mammary gland. |
