Recombinant Human X-Ray Repair Cross-Complementing Protein 5 (XRCC5) Protein (His)

Name: Recombinant Human X-Ray Repair Cross-Complementing Protein 5 (XRCC5) Protein (His)
Brand: Beta LifeScience
SKU: BLC-09302P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human X-Ray Repair Cross-Complementing Protein 5 (XRCC5) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P13010
Target Symbol	XRCC5
Synonyms	86 kDa subunit of Ku antigen; ATP dependent DNA helicase 2 subunit 2; ATP dependent DNA helicase II 80 kDa subunit; ATP dependent DNA helicase II 86 Kd subunit; ATP dependent DNA helicase II; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; CTC box binding factor 85 kDa; CTC box-binding factor 85 kDa subunit; CTC85; CTCBF; DNA repair protein XRCC5; KARP 1; KARP1; Ku 80; Ku autoantigen 80kDa; Ku80; Ku86; Ku86 autoantigen related protein 1; KUB 2; KUB2; Lupus Ku autoantigen protein p86; NFIV; Nuclear factor IV; Thyroid lupus autoantigen; Thyroid-lupus autoantigen; TLAA; X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining); X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X-ray repair cross-complementing protein 5; Xray repair complementing defective repair in Chinese hamster cells 5; XRCC 5; XRCC5; XRCC5_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVD
Expression Range	251-455aa
Protein Length	Partial
Mol. Weight	27.4kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Single-stranded DNA-dependent ATP-dependent helicase that plays a key role in DNA non-homologous end joining (NHEJ) by recruiting DNA-PK to DNA. Required for double-strand break repair and V(D)J recombination. Also has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. During NHEJ, the XRCC5-XRRC6 dimer performs the recognition step: it recognizes and binds to the broken ends of the DNA and protects them from further resection. Binding to DNA may be mediated by XRCC6. The XRCC5-XRRC6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5-XRRC6 dimer is probably involved in stabilizing broken DNA ends and bringing them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. The XRCC5-XRRC6 dimer probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. XRCC5 probably acts as the catalytic subunit of 5'-dRP activity, and allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5-XRRC6 dimer together with APEX1 acts as a negative regulator of transcription. In association with NAA15, the XRCC5-XRRC6 dimer binds to the osteocalcin promoter and activates osteocalcin expression. As part of the DNA-PK complex, involved in the early steps of ribosome assembly by promoting the processing of precursor rRNA into mature 18S rRNA in the small-subunit processome. Binding to U3 small nucleolar RNA, recruits PRKDC and XRCC5/Ku86 to the small-subunit processome. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
Subcellular Location	Nucleus. Nucleus, nucleolus. Chromosome.
Protein Families	Ku80 family
Database References	HGNC: 12833 OMIM: 194364 KEGG: hsa:7520 STRING: 9606.ENSP00000375977 UniGene: PMID: 27641979 these results suggest that polymorphisms of XRCC5 play an important role in astrocytoma prognosis in the Chinese Han population which could be used in the determination of astrocytoma prognosis in clinical researches PMID: 27852033 SAF-A, in concert with Ku, temporally regulates base damage repair in irradiated cell genome. PMID: 27303920 High XRCC5 expresiion is associated with medullary thyroid carcinoma. PMID: 26870890 Ku80 can be cleaved by caspases-2 at D726 upon a transient etoposide treatment. Caspase-2-mediated Ku80 cleavage promotes Ku80/DNA-PKcs interaction as the D726A mutation diminished Ku80 interaction with DNA-PKcs PMID: 29065392 m-calpain translocated as the result of calcium influx was involved in DNA double-strand breaks repair, especially in the non-homologous end-joining pathway through proteolysis of nuclear Ku80. Cleaved Ku80 was still able to form a heterodimer with Ku70 and enhance DNA repair activity. PMID: 27121057 Ku80 CTR (C-terminal region) is required for interaction with DNA-PKcs on short segments of blunt ended 25bp dsDNA or 25bp dsDNA with a 15-base poly dA ssDNA extension, but this requirement is less stringent on longer dsDNA molecules (35bp blunt ended dsDNA) or 25bp duplex DNA with either a 15-base poly dT or poly dC ssDNA extension. Moreover, DNA-PKcs-Ku complex forms on 25 bp DNA with poly-pyrimidine ssDNA extension. PMID: 28641126 Ku80 could predict the probability of resistance to neoadjuvant chemotherapy in lung adenocarcinoma, and reduced cisplatin and pemetrexed-induced apoptosis in A549 cells PMID: 28399858 results demonstrated that XRCC5 promoted colon cancer growth by cooperating with p300 to regulate COX-2 expression, and suggested that the XRCC5/p300/COX-2 signaling pathway was a potential target in the treatment of colon cancers PMID: 29049411 Ku antigen displays the AP lyase activity on a certain type of double-stranded DNA. PMID: 27129632 Results show that DDB2 is critical for chromatin association of XRCC5/6 in the absence of DNA damage and provide evidence that XRCC5/6 are functional partners of DDB2 in its transcriptional stimulatory activity. PMID: 28035050 RNF126 is a novel regulator of NHEJ that promotes completion of DNA repair by ubiquitylating Ku80 and releasing Ku70/80 from damaged DNA. PMID: 27895153 XRCC5 (rs1051685, rs6941) and AQP2 (10875989, rs3759125) polymorphisms were associated with hematologic toxicity of platinum-based chemotherapy in lung cancer patients PMID: 26358256 Ku80 and PDGFR-alpha might be effective predictive indicators for the prognosis of nasal type NK/T cell lymphoma PMID: 26778387 DNA methylation modification plays an important role to regulate the gene expression of XRCC5 and XRCC7, from the results that the gene methylation level of the glioma group is higher than that of the normal group PMID: 26464705 Data suggest that heat shock factor 1 (HSF1) interacts with both Ku autoantigens Ku70 and Ku86 to induce defective non-homologous end joining (NHEJ) repair activity and genomic instability. PMID: 26359349 The present study showed that the XRCC5 locus might be a contributor to COPD susceptibility in the Chinese Han population. PMID: 24615081 Depletion of Ku80 in the lens through acute change or a consequence of aging is likely to increase levels of DNA strand breaks, which could negatively influence physiological function and promote lens opacity PMID: 26658510 Data show that ubiquitin E3 ligase RNF138 regulates Ku80 antigen ubiquitylation in response to DNA damage. PMID: 26502055 Polymorphisms in the Variable Number of Tandem Repeats at the promoter region of the XRCC5 is associated with gastric cancer. PMID: 25527410 retinoblastoma tumor suppressor protein variants disabled for the interaction with XRCC5 and XRCC6, including a cancer-associated variant, are unable to support canonical non-homologous end-joining despite being able to confer cell-cycle control PMID: 25818292 Genome-wide gene-set-based analysis and follow-up studies in Drosophila and humans generated independent evidence for the involvement of XRCC5 (Ku80) in alcohol dependence PMID: 25035082 Our data indicated that Ku80 expression level associates with key clinicopathological features and is an independent predictor of the OS and the DFS in pT2N0M0 ESCC patients. PMID: 25758053 Polymorphism in XRCC5 gene is associated with Systemic Lupus Erythematosus. PMID: 25756210 both the CG carriers/G allele carriers of rs2267437 (XRCC6) and the haplotype AT/CC established by the SNPs of XRCC5 are associated with ESCC (Esophageal Squamous Cell Carcinoma) susceptibility. PMID: 25702660 the downregulation of Ku80 and an impairment of repair activity in squamous cells, which are mediated by miR-31. PMID: 25082302 RECQL4 stimulates higher order DNA binding of Ku70/Ku80 to a blunt end DNA substrate. Taken together, these results implicate that RECQL4 participates in the NHEJ pathway of DSB repair via a functional interaction with the Ku70/Ku80 complex. PMID: 24942867 High KU86 expression is associated with hepatocellular carcinoma. PMID: 24811221 the VNTR polymorphism at the promoter region of XRCC5, but not XRCC6, may have a role in breast cancer risk or age at diagnosis of breast cancer PMID: 24615008 down-regulation of Ku80 can sensitize ALT cells U2OS to radiation, and this radiosensitization is related to telomere length shortening. PMID: 23621240 the VNTR polymorphism in the promoter region of XRCC5 gene could serve as an important prognostic marker in CML development. PMID: 23982877 Ku86 staining in hepatocellular carcinoma was much stronger than in para-tumor and normal tissues. Expression of Ku86 was related to the tumor size, TNM stage, and tumor differentiation. Long-term survival of patients with low Ku86 expression was longer. PMID: 24271118 Enhanced DNA-PKcs and Ku 70/80 expression may be closely associated with gastric carcinoma. PMID: 24187467 The observations plead in favor of the hypothesis that Ku has an impact on HIV-1 expression and latency at early- and mid-time after integration. PMID: 23922776 For XRCC4P and XRCC5P, only XRCC4P modified liver cancer risk. PMID: 23788213 Processivity factor 8 (PF-8) of Kaposi's sarcoma-associated herpesvirus was identified as interacting with Ku70 and Ku86, and the interaction was dependent on DNA double-strand breaks and DNA. PMID: 23677788 In systemic lupus spectrum diseases, anti-Ku are found associated with other autoantibodies; in systemic sclerosis anti-Ku are frequently associated with myositis and interstitial lung disease. PMID: 23910615 This model highlights the importance of Ku70/80 oxidation which leads to increased Ku70/80 dissociation rates from DNA damage foci and shifts repair in favour of the less efficient Back-up-Non-Homologous End Joining system. PMID: 23457464 The 3R allele of the VNTR polymorphism in the XRCC5 promoter region dramatically decreases the gene expression. PMID: 23220236 Two (XRCC5 and TOP2A) of seven DNA repair and replication proteins studied were prognostic for melanoma. PMID: 23020778 BRCA1-Ku80 protein interaction enhances end-joining fidelity of chromosomal double-strand breaks in the G1 phase of the cell cycle PMID: 23344954 Ku80 expression level could predict the outcome and the sensitivity to cisplatin-based chemotherapy in patients with lung adenocarcinoma PMID: 23181744 Results show the N-terminal region mediates the interaction between DNA-PKcs and the Ku70/Ku80-DNA complex and is required for its DNA double-stranded breaks (DSBs)-induced enzymatic activity. PMID: 23322783 XRCC5 gene polymorphism is associated with breast cancer. PMID: 23098447 It is suggested that the prevalence of the XRCC5 novel allele (3R allele) among European populations may be higher than its prevalence among Iranians. PMID: 23022196 APLF promotes the assembly and activity of multi-protein Ku-DNA complexes containing all of the Non-homologous end joining (NHEJ) factors required for DNA ligation. PMID: 23178593 Data indicate a significant positive association was found between female patients with anti-Ku p70 and joint/bone features, and a significant negative association was found between female patients with anti-Ku p80 only and joint/bone features. PMID: 22226402 Data indicate that dynamic remodeling of the Ku complex coincided with exit of Ku and other DNA repair proteins from the nucleolus. PMID: 22535209 study found Ku80 was downregulated in hepatocellular carcinoma(HCC) and Ku80 downregulation was correlated with elevated HBV-DNA load and liver cirrhosis; suggested an underlying mechanism in which Ku80 functions as a tumor suppressor in HCC by inducing S-phase arrest through a p53-dependent pathway PMID: 22226916 Ku70/80 binds to DNA double strand breaks (DSB) in all cell cycle stages and is likely actively displaced from DSB ends to free the DNA ends for DNA end resection and thus homologous recombination to occur. PMID: 22265216

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.