Recombinant Human Visinin-Like Protein 1 (VSNL1) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-03974P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Visinin-Like Protein 1 (VSNL1) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-03974P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Visinin-Like Protein 1 (VSNL1) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P62760
Target Symbol VSNL1
Synonyms 21 kDa CABP; Hippocalcin like protein 3; Hippocalcin-like protein 3; HLP 3; HLP3; HPCAL 3; HPCAL3; HUVISL1; Neural visinin-like protein 1; Neural visinin-like type 1 protein; Neurocalcin alpha; NVL 1; NVL1; Nvp1; OZ1; Ratnvp1; VILIP; VILIP-1; Visinin; Visinin like 1; Visinin like protein 1; Visinin-like protein 1; VISL 1; VISL1; VISL1_HUMAN; VLP-1; Vnsl1; Vsnl1
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
Expression Range 1-191aa
Protein Length Full Length
Mol. Weight 49.0kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Regulates (in vitro) the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.
Protein Families Recoverin family
Database References

HGNC: 12722

OMIM: 600817

KEGG: hsa:7447

STRING: 9606.ENSP00000295156

UniGene: PMID: 26683098

  • These data indicate that VILIP-1 alone or in combination with other AD CSF biomarkers represent a valuable marker for the early diagnosis of AD, recognition of MCI patients at higher risk to develop dementia, and in differentiating AD from LBD. PMID: 26836160
  • These findings suggest a unique role for cerebrospinal fluid Vilip-1 as a biomarker of entorhinal cortex neuron loss in Alzheimer disease PMID: 26769253
  • The results suggest that both serum and cerebrospinal fluid levels of VILIP-1 may be one of predictive markers of acute encephalopathy with biphasic seizures. PMID: 24075506
  • We show for the first time that the C-terminus of VILIP-1, containing Cys187, might represent a novel redox-sensitive motif and that VILIP-1 dimerization and aggregation are hallmarks of amyotrophic lateral sclerosis PMID: 24742816
  • Results show that in the presence of calcium, N-myristoylation significantly increases the kinetic rate of VILIP adsorption to the membrane. PMID: 25019684
  • The results showed that the CSF VILIP-1 level had significantly increased in Alzheimer disease patients compared with both normal controls and Lewy body dementia patients. PMID: 23800322
  • SNPs upstream of SLC2A9 and within VSNL1 showed strongest evidence for association with AD + P when compared with controls. PMID: 22005930
  • VSNL1 single-nucleotide polymorphisms and pathological changes in VILIP-1 protein expression, possibly occurring during brain development, may contribute to the morphological and functional deficits observed in schizophrenia. PMID: 22832524
  • Patients with high VSNL-1 expression had significantly poorer prognosis than those with low expression in stage III disease PMID: 22052372
  • The findings suggest that CSF VILIP-1 and VILIP-1/Abeta42 predict rates of global cognitive decline similarly to tau and tau/Abeta42, and may be useful CSF surrogates for neurodegeneration in early Alzheimer disease. PMID: 22357717
  • VSNL1 may play a role in the pathophysiology of aldosterone-producing adenomas harboring mutations in the potassium channel KCNJ5 via its antiapoptotic function in response to calcium cytotoxicity and its effect on aldosterone production. PMID: 22331379
  • Data suggest that CSF VILIP-1 and VILIP-1/Abeta42 offer diagnostic utility for early AD, and can predict future cognitive impairment in cognitively normal individuals similarly to tau and tau/Abeta42, respectively. PMID: 21823155
  • VILIP-1 forms a dimer in solution independent of Ca(2+) and myristoylation. The dimerization site is composed of residues in EF4 and the loop region between EF3 and EF4, confirmed by mutagenesis. PMID: 21169352
  • Results show that VILIP-1 regulates the cell surface localization of natriuretic peptide receptor B. PMID: 20079378
  • A shift in the cellular expression of visinin-like protein 1 has been found in the hipppocampi of schizophrenics, since fewer pyramidal neurons but more interneurons show immunoreactivity. PMID: 11930147
  • EF-hand motifs in visinin-like protein 1 PMID: 12200122
  • The interaction of human VILIP1 and VILIP3 with divalent cations was explored using circular dichroism and fluorescence measurement. PMID: 16703469
  • VILIP-1 is expressed in pancreatic beta-cells. Increased VILIP-1 enhanced insulin secretion in a cAMP-associated manner. Down-regulation of VILIP-1 was accompanied by decreased cAMP accumulation but increased insulin gene transcription PMID: 16731532
  • Distinct roles of proliferative and invasive phenotypes contributing to neuroblastoma progression which demonstrates that VSNL-1 is important in neuroblastoma metastasis. PMID: 17615261
  • VILIP-1 expression is silenced by promoter hypermethylation and histone deacetylation in aggressive NSCLC cell lines and primary tumors PMID: 18301774
  • VILIP-1 and its interaction partner nicotinic receptor alpha4beta2 co-localize in morphologically identified human hippocampal interneurons, the number of which is pathologically up-regulated in schizophrenic brains. PMID: 18691652
  • VILIP1 constitutively binds to P2X2 receptors and displays enhanced interactions in an activation- and calcium-dependent manner owing to exposure of its binding segment in P2X2 receptors PMID: 18922787
  • Results report that overexpression of VILIP-1 enhances ACh responsiveness, whereas siRNA against VILIP-1 reduces alpha4beta2 nAChR currents of hippocampal neurons. PMID: 19063970
  • Data may imply the functional contribution of disulfide dimer to the interaction of VILIP-1 with its physiological target(s). PMID: 19065602
  • Deletion and site-directed mutagenesis combined with in silico transcription factor binding analysis of VSNL1 promoter identified nuclear respiratory factor (NRF)-1/alpha-PAL as a major player in regulating VSNL1 minimal promoter activity. PMID: 19674972
  • VILIP-1 modulates cAMP-accumulation in C6 glioma cells PMID: 9109541
  • VILIP-1 expression is associated with group I mGlu receptor-mediated plasticity in the dentate gyrus in vivo PMID: 12681369
  • VILIP-1 is associated with amyloid plaques and extracellular tangles in Alzheimer disease and promotes cell death and tau phosphorylation in vitro PMID: 11592857
  • VILIP-1 interacts with cell membrane and actin-based cytoskeleton PMID: 8780737
  • VILIP-1 modulates cGMP-accumulation in transfected neural cells and cerebellar granule neurons PMID: 11579136
  • reversibility and stimulus-dependent occurrence of a calcium-myristoyl switch of VILIP-1 in living neurons, enabling them to activate specific targets localized in distinct membrane compartments PMID: 12196554
  • VILIP-1 modulates the surface expression and agonist sensitivity of the alpha 4beta 2 nicotinic acetylcholine receptor PMID: 12202488
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed