Recombinant Human Very Long-Chain Acyl-Coa Synthetase (SLC27A2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10716P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Very Long-Chain Acyl-Coa Synthetase (SLC27A2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10716P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Very Long-Chain Acyl-Coa Synthetase (SLC27A2) Protein (His-SUMO) is produced by our E.coli expression system. This is a cytoplasmic protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O14975 |
| Target Symbol | SLC27A2 |
| Synonyms | ACSVL1; FACVL1; FATP 2; FATP-2; FATP2; Fatty acid coenzyme A ligase, very long chain 1; Fatty acid transport protein 2; Fatty-acid-coenzyme A ligase; hFACVL1; HsT17226; Long chain fatty acid CoA ligase; Long-chain-fatty-acid--CoA ligase; S27A2_HUMAN; Slc27a2; Solute carrier family 27 (fatty acid transporter), member 2; Solute carrier family 27 member 2; THCA CoA ligase; THCA-CoA ligase; Very long chain acyl CoA synthetase; Very long chain fatty acid CoA ligase; Very long chain fatty acid coenzyme A ligase 1; very long-chain 1; Very long-chain acyl-CoA synthetase; Very long-chain-fatty-acid-CoA ligase; VLACS; VLCS |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | GATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL |
| Expression Range | 283-620aa |
| Protein Length | Cytoplasmic Domain |
| Mol. Weight | 54.8kDa |
| Research Area | Metabolism |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acyl CoA synthetase that activates long-chain and very long-chain fatty acids (VLCFAs) by catalyzing the formation of fatty acyl-CoA. Can also activate branched-chain fatty acids such as phytanic acid and pristanic acid. Does not activate C24 bile acids, cholate and chenodeoxycholate. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Exhibits long-chain fatty acids (LCFA) transport activity and plays an important role in hepatic fatty acid uptake.; Exhibits both long-chain fatty acids (LCFA) transport activity and acyl CoA synthetase towards very long-chain fatty acids. Shows a preference for generating CoA derivatives of n-3 fatty acids, which are preferentially trafficked into phosphatidylinositol.; Exhibits long-chain fatty acids (LCFA) transport activity but lacks acyl CoA synthetase towards very long-chain fatty acids. |
| Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Peroxisome membrane; Peripheral membrane protein. Cell membrane; Multi-pass membrane protein. Microsome. |
| Protein Families | ATP-dependent AMP-binding enzyme family |
| Database References | HGNC: 10996 OMIM: 603247 KEGG: hsa:11001 STRING: 9606.ENSP00000267842 UniGene: PMID: 27016784 |
