Recombinant Human Versican Core Protein (VCAN) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08018P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Versican Core Protein (VCAN) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-08018P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Versican Core Protein (VCAN) Protein (His&Myc) is produced by our Baculovirus expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P13611 |
Target Symbol | VCAN |
Synonyms | Chondroitin sulfate proteoglycan 2; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan core protein; cartilage; CSPG2; CSPG2_HUMAN; ERVR; GHAP; Glial hyaluronate binding protein; Glial hyaluronate-binding protein; Large fibroblast proteoglycan; PG-M; PGM; VCAN; Versican; Versican core protein; Versican proteoglycan; WGN 1; WGN; WGN1 |
Species | Homo sapiens (Human) |
Expression System | Baculovirus |
Tag | N-10His&C-Myc |
Target Protein Sequence | GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN |
Expression Range | 3089-3354aa |
Protein Length | Partial |
Mol. Weight | 34.6 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid. |
Subcellular Location | Secreted, extracellular space, extracellular matrix. Cell projection, cilium, photoreceptor outer segment. Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix. |
Protein Families | Aggrecan/versican proteoglycan family |
Database References | |
Associated Diseases | Wagner vitreoretinopathy (WGVRP) |
Tissue Specificity | Expressed in the retina (at protein level). Cerebral white matter and plasma. Isoform V0: Expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V1: Expressed in normal brain, gliomas, medulloblastomas, |
Gene Functions References
- VCAN expression in colorectal cancer and its role in cetuximab resistance PMID: 28320945
- miR-135a-5p can suppress cell progress including cell proliferation, migration, and invasion in thyroid carcinoma by targeting VCAN 3 '-UTR. PMID: 28869452
- This study highlights the oncogenic role of VCAN in renal cell carcinogenesis and suggests that this gene has therapeutic and/or biomarker potential for renal cell cancer. PMID: 28242813
- Interleukin-17A promotes tongue squamous cell carcinoma metastasis by activating miR-23b/versican pathway in the tumor microenvironment. PMID: 28035060
- The macular dysfunction on mfERG was profound and of early onset. A heterozygous mutation in intron 7 of the VCAN gene (c.4004-1G > A) was found. PMID: 29071374
- Versican V0 and V1 isoforms were upregulated in the uterine leiomyomas of symptomatic versus asymptomatic women. Abundant cleaved versican was detected in leiomyoma and myometrium, as well as in myometrial and leiomyoma cell lines. VCAN siRNA did not effect cell proliferation, apoptosis, or smooth muscle markers, but reduced ESR1 and PR-A expression. PMID: 28323982
- Lumican and versican protein expression are associated with colorectal adenoma-to-carcinoma progression PMID: 28481899
- Removal or knockdown of versican may be a possible therapeutic strategy for increasing deposition of insoluble elastin and stimulating repair of elastic fibers in COPD lung. PMID: 28138236
- human myeloma tumors displaying CD8(+) infiltration/aggregates underwent VCAN proteolysis at a site predicted to generate a glycosaminoglycan-bereft N-terminal fragment. PMID: 27259980
- versican decreases in follicular dermal papilla as an aging-associated change of human hair follicles PMID: 27697422
- Data indicate that serum versican levels were significantly decreased in polycystic ovary syndrome (PCOS) patients, and that serum ADAMTS-1 (a disintegrin and metalloproteinase with thrombospondin motif-1) and versican levels were significantly and positively correlated with each other. PMID: 27908842
- the G1 domain of versican can regulate the organization of pericellular hyaluronan and affect phenotype of cultured human dermal fibroblasts PMID: 27126822
- Results highlight an important role for versican in regulating the expression and assembly of elastin and the phenotype of leiomyosarcoma cells. PMID: 26723257
- Versican localizes to the nucleus in proliferating mesenchymal cells and suggest role in mitotic spindle organization during cell division. PMID: 26395512
- VCAN and VEGF were associated with survival in CRC patients with PM after CRS and HIPEC PMID: 26873137
- Versican is a novel modulator of hepatic fibrosis. PMID: 26752747
- versican mRNA is up-regulated much more highly (>600 fold) by long term hypoxia (5 days) than by 1 day of hypoxia. PMID: 26057378
- Versican V1 overexpression induces a myofibroblast-like phenotype in cultured fibroblasts. PMID: 26176948
- Versican upregulation in Sezary cells alters growth, motility and resistance to chemotherapy. PMID: 25915825
- Versican isoform V1 is associated with high-grade gliomas. PMID: 25064688
- Significant elevation of VCAN and its associated molecules imply their role in multiple myeloma PMID: 25623955
- Our results suggest that TGF-beta1 up-regulates versican expression by suppressing miR-143, and this pathway is important for osteosarcoma cell migration and invasion. PMID: 25562163
- Circulating monocytes may contribute to the fibrotic process in a subset of systemic sclerosis patients by amplifying a positive feedback loop consisting of versican, CCL2, and the influx of monocytes PMID: 23845159
- Arylsulfatase B regulates versican expression by galectin-3 and AP-1 mediated transcriptional effects. PMID: 24240681
- Versican regulates the growth of leiomyosarcoma tumors. PMID: 25320080
- these data suggest that versican regulates the development of peritoneal metastasis originating from cells and spheroids. PMID: 24999371
- The ADAMTS5 ancillary domain and specific chondroitin sulfate chains of versican are required for proteolysis. PMID: 25122765
- Versican expression in tumor epithelial cells predicts a good prognosis for gastric cancer patients. PMID: 25275064
- Lack of versican expression is associated with recurrence in colon cancer. PMID: 22711178
- CD26 expression on T-anaplastic large cell lymphoma (ALCL) line Karpas 299 is associated with increased expression of versican and MT1-MMP and enhanced adhesion. PMID: 24180670
- FoxQ1 promotes hepatocellular carcinoma metastasis by transactivating ZEB2 and VersicanV1 expression. PMID: 24005989
- A novel c.4004-6T>A nucleotide substitution at the acceptor splice site of intron 7 of the VCAN gene that segregated with the Wagner disease phenotype, was identified. PMID: 24174867
- Cleaved versican G1 domain-containing fragments (VG1F) can be recaptured by microfibrils through VG1F homotypical interactions to enhance hyaluronan recruitment to microfibrils. PMID: 23963449
- altered balance of VCAN splice variants in combination with reduction in glycosaminoglycan protein modifications as pathogenic mechanisms in Wagner syndrome PMID: 22739342
- Letter/Case Report: disease causing versican mutation in Wagner syndrome. PMID: 23571384
- versican V1 enhances hCAP18/LL-37 expression in macrophages through activation of TLR2 and subsequent vitamin D-dependent mechanisms which promote ovarian tumor progression in vitro PMID: 23424670
- No association has been found between polymorphisms of rs251124 and rs3767137 loci of CSPG2 and HSPG2 genes and intracranial aneurysm in the selected population. PMID: 23568740
- Wnt/beta-catenin signal transducting system regulates dermal papilla cell aggregative growth through modifying versican expression by means of acting on the versican gene upstream promoter. PMID: 23099107
- these results demonstrate that versican V0 and V1 isoforms play important roles in HCC development and that versican mRNAs compete with endogenous RNAs in regulating miRNA functions. PMID: 23180826
- Mesenchymal cells derived from keloid lesion (KL) cells exhibit above-normal versican production. PMID: 22951719
- the glioblastoma cell line U87 stably transfected with versican isoform V2 formed tumors containing extensive vasculature PMID: 23201264
- renal versican expression was significantly upregulated as compared to corresponding controls. These data show for the first time an association of renal versican isoform V0 and V1 expression with progressive renal disease. PMID: 23024773
- Studies indicate that E-cadherin and versican are involved in cancer epithelial-mesenchymal transitions and metastasis. PMID: 23002209
- Tissue microarray analysis revealed that epithelial expression of versican had significant relations to lymph node metastasis and pathological stages of breast cancer PMID: 22318369
- E(2) treatment increases the amount of dermal HA and versican V2 via paracrine release of EGF, which may be implicated in the pro-proliferative and anti-inflammatory effects of E(2) during photoaging. PMID: 22493503
- The major isoforms expressed by gastric carcinoma & gastric cell lines were V0 & V1. V1 was higher in gastric carcinoma. Abnormally expressed versican & its isoforms participate in the progress of gastric carcinoma triggered by IL-11. PMID: 22393310
- RhoGDI2 suppresses lung metastasis in mouse models by reducing the expression of isoforms V1 and V3 of the proteoglycan versican, which is require for lung metastasis. High versican levels portended poor prognosis in patients with bladder cancer. PMID: 22406535
- Hyaluronan and versican play a role in T-cell trafficking and function in inflamed tissues. PMID: 22155153
- Versican is a key component of the provisional wound repair ECM that is expressed following injury to valvular interstitial cells. PMID: 21546273
- the G1 and G3 domains of versican were upregulated and LTBP-4 was downregulated in breast cancer stroma PMID: 21505857