Recombinant Human Vasopressin V1B Receptor (AVPR1B) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00402P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Vasopressin V1B Receptor (AVPR1B) Protein (His)

Beta LifeScience SKU/CAT #: BLC-00402P
Save $2,567
/
Size

Product Overview

Description Recombinant Human Vasopressin V1B Receptor (AVPR1B) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P47901
Target Symbol AVPR1B
Species Homo sapiens (Human)
Expression System in vitro E.coli expression system
Tag N-10His
Target Protein Sequence MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF
Expression Range 1-424aa
Protein Length Full Length
Mol. Weight 53.0 kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.; (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, may recognize and internalize the complex formed by AVP/Arg-vasopressin, SARS-CoV-2 spike protein and secreted ACE2 through DNM2/dynamin 2-dependent endocytosis.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Protein Families G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Database References

Gene Functions References

  1. Patients were different from those previously studied. We measured the expression of the pituitary-specific hormone genes and type 1 corticotrophin-releasing hormone and arginine vasopressin 1b receptors, by quantitative real-time polymerase chain reaction using TaqMan probes. PMID: 29979686
  2. Polymorphisms of CRHR1 and AVPR1b may modify susceptibility to mood disorders. PMID: 23962971
  3. The results suggest that the AVPR1B gene rs28373064 is linked to emotional empathy and prosociality. PMID: 26354157
  4. AA genotype of rs28418396 single-nucleotide polymorphism near the arginine vasopressin receptor 1b gene is associated with serious adverse events in patients with septic shock treated with vasopressin and norepinephrine. PMID: 24919159
  5. Genetic variance of arginine vasopressin receptor 1B(AVPR1B) contributes to overweight and data indicate a link between AVPR1B variance and diabetes mellitus development PMID: 26503846
  6. The association of AVPR1B G*A-haplotype (rs28632197 and rs33911258, respectively) and decreased Self-transcendence (TCI-125) was demonstrated in the total sample and in Udmurts. PMID: 25438555
  7. Participants carrying both GG/GA variant of AVPR1b rs28373064 and AA variant of clock rs6832769 showed highest scores on the Emotional prosocial tendency measure. the clock gene and OXT/AVP systems are intertwined and contribute to human prosociality. PMID: 25309987
  8. The associations of the AVP 1B receptor may be specific to reactive, emotional rather than proactive or callous types of aggression. PMID: 24842238
  9. association between polymorphisms of AVPR1b gene and psychotic dimension.possible involvement of the AVPR1b gene in the etiology of psychotic features in the course of affective disorders PMID: 24012103
  10. AVPR1B genetic variation has a role in suicide attempt etiology characterized by elevated depression levels. PMID: 23422793
  11. The results of thi study showed that no association was found for alleles, genotypes, or haplotype analysis for AVPR1b genes and melancholic depression. PMID: 23068076
  12. This is the first report of a genetic association between vasopressin receptor 1B and child aggression. PMID: 22910476
  13. polymorphism rs28536160 genotype TT of the AVPR1b gene may increase susceptibility for obtaining psychotic features in the course of bipolar disorder I. PMID: 22341483
  14. the presence of V1b receptors also found in human Langerhans islets could suggest hormonal control of AVP in human pancreas. PMID: 12736162
  15. Data supports a protective effect of this major haplotype for recurrent major depression. PMID: 15094789
  16. determination of a C-terminal motif required for export to plasma membrane PMID: 15528211
  17. V1bR and CRHR1 can form constitutive homo- and heterodimers. PMID: 17318384
  18. study found evidence to implicate the AVPR1B gene in the etiology of mood disorders, particularly in females PMID: 17909131
  19. polymorphisms in the AVPR1B and the CRHR1 genes alter the susceptibility to panic disorder PMID: 18384079
  20. AVPR1B is associated with autistic traits, empathy, and Asperger syndrome. PMID: 19598235
  21. An association analysis with AVPR1b single-nucleotide polymorphism for attention deficit hyperactivity disorder, was performed in a patient/control sample. PMID: 19668115

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Beta LifeScience's Promotion
Western Blot | Positive WB detected in: MCF-7 whole cell lysate, A549 whole cell lysate, Mouse thymus | All lanes: ACAA2 antibody at 1:2000 | Secondary | Goat polyclonal to rabbit IgG at 1/50000 dilution | Predicted band size: 42 kDa | Observed band size: 42 kDa
IHC image of ACAA2 Recombinant Monoclonal Antibody diluted at 1:100 and staining in paraffin-embedded human colon cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.05% DAB.
ACAA2 Recombinant Monoclonal Antibody
CAT#: BLC-06609A
IHC image of the antibody diluted at 1:100 and staining in paraffin-embedded human breast cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.07% DAB.
IHC image of Acetyl-HIST1H3A(K18) Recombinant Monoclonal Antibody diluted at 1:100 and staining in paraffin-embedded human gastric cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.07% DAB.
Acetyl-HIST1H3A(K18) Recombinant Monoclonal Antibody
CAT#: BLC-06595A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06518A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06519A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06520A
Western Blot | Positive WB detected in Hela whole cell lysate, MCF-7 whole cell lysate, 293 whole cell lysate, HepG2 whole cell lysate | All lanes Acetyl-Histone H4 (K5) antibody at 1.05μg/ml | Secondary | Goat polyclonal to rabbit IgG at 1/50000 dilution | Predicted band size: 11 KDa | Observed band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K5) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K5) Recombinant Monoclonal Antibody
CAT#: BLC-06516A
Recently viewed