Recombinant Human Vascular Endothelial Growth Factor D (VEGFD) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08393P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Vascular Endothelial Growth Factor D (VEGFD) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08393P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Vascular Endothelial Growth Factor D (VEGFD) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O43915 |
Target Symbol | VEGFD |
Synonyms | c-fos induced growth factor; c-fos induced growth factor (vascular endothelial growth factor D); c-fos induced growth factor; c-fos-induced growth factor; FIGF; Vascular endothelial growth factor D; Vascular endothelial growth factor D precursor; Vascular endothelial growth factor D precursor; VEGF D; VEGF-D; VEGFD; VEGFD_HUMAN |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR |
Expression Range | 89-205aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 40.1kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. |
Subcellular Location | Secreted. |
Protein Families | PDGF/VEGF growth factor family |
Database References | HGNC: 3708 OMIM: 300091 KEGG: hsa:2277 STRING: 9606.ENSP00000297904 UniGene: PMID: 29075785 |