Recombinant Human Valacyclovir Hydrolase (BPHL) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04529P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Valacyclovir Hydrolase (BPHL) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-04529P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Valacyclovir Hydrolase (BPHL) Protein (His&Myc) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q86WA6 |
| Target Symbol | BPHL |
| Synonyms | Biphenyl hydrolase like ; Biphenyl hydrolase related ; biphenyl hydrolase-like (serine hydrolase); Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Bphl; BPHL_HUMAN; Bphrp; Breast epithelial mucin associated antigen ; Breast epithelial mucin-associated antigen; MCNAA; Mucin-associated antigen; VACVase; Valacyclovir hydrolase; Valacyclovirase |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ |
| Expression Range | 38-291aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 32.8 kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol. |
| Protein Families | AB hydrolase superfamily, Lipase family |
| Database References | |
| Tissue Specificity | Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle. |
