Recombinant Human V-Type Proton Atpase Subunit D 1 (ATP6V0D1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03973P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human V-Type Proton Atpase Subunit D 1 (ATP6V0D1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03973P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human V-Type Proton Atpase Subunit D 1 (ATP6V0D1) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P61421 |
| Target Symbol | ATP6V0D1 |
| Synonyms | 32 kDa accessory protein; ATP6D; ATP6DV; ATP6V0D1; ATPase H+ transporting lysosomal (vacuolar proton pump) member D; ATPase H+ transporting lysosomal 38kD V0 subunit d; ATPase H+ transporting lysosomal 38kDa V0 subunit d1; ATPase H+ transporting lysosomal V0 subunit d1; H(+) transporting two sector ATPase subunit D; p39; V ATPase 40 KDa accessory protein; V ATPase AC39 subunit; V ATPase subunit d 1; V ATPase subunit D; V-ATPase 40 kDa accessory protein; V-ATPase AC39 subunit; V-ATPase subunit d 1; V-type proton ATPase subunit d 1; VA0D1_HUMAN; Vacuolar ATP synthase subunit d 1; Vacuolar proton pump subunit d 1; VATX; VMA 6; VMA6; VPATPD |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF |
| Expression Range | 1-351aa |
| Protein Length | Full Length |
| Mol. Weight | 67.3kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Subunit of the integral membrane V0 complex of the lysosomal proton-transporting V-type ATPase (v-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium. |
| Subcellular Location | Membrane; Peripheral membrane protein; Cytoplasmic side. Lysosome membrane. |
| Protein Families | V-ATPase V0D/AC39 subunit family |
| Database References | HGNC: 13724 OMIM: 607028 KEGG: hsa:9114 STRING: 9606.ENSP00000290949 UniGene: PMID: 24631925 |
