Recombinant Human V-Set Domain-Containing T-Cell Activation Inhibitor 1 (B7H4) Protein (His)

Name: Recombinant Human V-Set Domain-Containing T-Cell Activation Inhibitor 1 (B7H4) Protein (His)
Brand: Beta LifeScience
SKU: BLC-11147P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human V-Set Domain-Containing T-Cell Activation Inhibitor 1 (B7H4) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q7Z7D3
Target Symbol	B7H4
Synonyms	B7 family member, H4; B7 H4; B7 homolog 4; B7 superfamily member 1; B7 superfamily, member 1; B7-H4; B7h.5; B7h4; B7S1; B7x; BC032925; Immune costimulatory protein B7-H4; Immune costimulatory protein B7H4; MGC41287; PRO1291; Protein B7S1; RP11 229A19.4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; V set domain-containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; VCTN1; Vtcn1; VTCN1_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Expression Range	26-258aa
Protein Length	Partial
Mol. Weight	29.6kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Protein Families	Immunoglobulin superfamily, BTN/MOG family
Database References	HGNC: 28873 OMIM: 608162 KEGG: hsa:79679 STRING: 9606.ENSP00000358470 UniGene: PMID: 28425229 B7-H4/NF-kappaB signaling is involved in the EMT and invasion of bladder cancer cells. PMID: 29391086 The aim of the present work was to evaluate the effectiveness of anti-B7-H4-scFv-CH3 against tumors in vitro and in vivo. ScFv can inhibit signaling pathways to improve immunity by binding with the T lymphocyte negative co-stimulatory factor B7-H4. PMID: 30207312 High B7-H4 expression is associated with phyllodes tumors. PMID: 30486739 Studies suggest that V-set domain containing T cell activation inhibitor 1 protein (B7S1) may represent a very promising candidate to be targeted to treat various tumors. PMID: 30069671 Human Immunodeficiency virus type-1 myeloid derived suppressor cells inhibit cytomegalovirus inflammation through IL-27 and B7-H4. PMID: 28338007 High B7-H4 expression is associated with glioblastoma. PMID: 30159779 Serum B7-H4 detection, either alone or in combination with carbohydrate antigen 125, has an acceptable value in the diagnosis of OC. PMID: 29970702 the findings of this study suggested that B7-H4 may have the potential to be a valuable prognostic marker and a target for individualized therapies for gastric cancer PMID: 29436630 Upregulation of B7-H4 promotes tumor progression of intrahepatic cholangiocarcinoma. PMID: 29235470 B7-H3 protein is expressed in the majority of NSCLCs and is associated with smoking history. High levels of B7-H3 protein have a negative prognostic impact in lung carcinomas. Coexpression of B7-H3 with PD-L1 and B7-H4 is relatively low, suggesting a nonredundant biological role of these targets. PMID: 28539467 When compared to early-stage lung adenocarcinoma, metastatic pleural adenocarcinoma possessed higher level of nuclei membranous B7-H4 and lower cytoplasmic B7-H4 expression. PMID: 28923053 The decrease of B7-H4 expression in salivary glands of Sjogren's syndrome patients contributes to the defect of negatively regulating the inflammation caused by CD4(+) T cells. PMID: 28217953 Preclinical investigation into B7-H4-specific chimeric antigen receptor (CAR) T cells, antibody-mediated blockade of B7-H4, and anti-B7-H4 drug conjugates has shown antitumor efficacy in mouse models. PMID: 28325750 This meta-analysis demonstrated that high B7-H4 expression is an unfavorable prognostic factor in NSCLC. PMID: 28404927 This meta-analysis clarified that high B7-H4 expression in tissue was significantly associated with poor survival in patients with solid tumors. PMID: 27058425 in pulmonary adenocarcinoma presenting with SPN, nuclear membrane localization of B7-H4 within the tumor cells is associated with increased malignancy PMID: 27438152 Study reportes that B7-H3 and B7-H4 are highly expressed in human esophageal cancer tissues and significantly associated with tumor invasion. PMID: 27764786 Results revealed B7-H4 to be associated with poor prognosis in patients with pancreatic cancer liver metastasis. B7-H4 may promote pancreatic cancer metastasis. PMID: 27750217 PD-L1, IDO-1, and B7-H4 are differentially expressed in human lung carcinomas and show limited co-expression. While PD-L1 and IDO-1 are associated with increased tumor-infiltrating lymphoycte and IFN-gamma stimulation, B7-H4 is not. PMID: 27440266 B7-H4 activation on Mphis/microglia in the microenvironment of gliomas is an important immunosuppressive event blocking effective T-cell immune responses. PMID: 27001312 Knockdown of B7-H4 significantly up-regulated 57 miRNAs and down-regulated 14 miRNAs. PMID: 29145206 Increased serum levels of sB7-H4 in early pregnancy in premature rupture of the amniotic membranes cases may indicate the dynamics of the immune response at the feto-maternal interface and, thus, may serve as a predictive marker for this pregnancy complication. PMID: 27302185 our study demonstrates a strong promoting role of B7-H4 in lung tumor growth, progression and metastasis PMID: 28061481 results demonstrated for the first time that miR-125b-5p could regulate the inflammatory state of macrophages via directly targeting B7-H4 PMID: 28754594 B7-H4 is highly expressed in pancreatic cancer, and is an independent predictor of poor prognosis. PMID: 28600225 Evidence of associations between genotypes and Juvenile Idiopathic Arthritis were found for VTCN1, while VTCN1_rs2358820 GA was associated with Uveitis . PMID: 28145159 B7-H4 is highly expressed in human OSCC tissue, and the B7-H4 expression level was associated with the clinicopathological parameters containing pathological grade and lymph node status. PMID: 27383830 High B7-H4 expression is associated with non-Hodgkin lymphoma. PMID: 28246881 B7-H4 is frequently expressed in ovarian serous carcinomas, especially high-grade serous carcinomas, and may represent a novel immunotherapeutic target in this cancer. PMID: 27349304 While PD-L1 expression correlated with MSI and high grade endometrial tumors, B7-H4 expression was independent of grade, histology and immune cell infiltration. PMID: 28347512 the present review highlights the therapeutic potential of targeting B7-H4 in cancer PMID: 28258701 Survival rate of the patients with higher B7-H4 expression was significantly worse than that of the patients with lower B7-H4 expression. PMID: 28412458 Study provides evidence that B7-H4 expression is present in cervical intraepithelial neoplasia and cervical cancer patients and suggests its involvement in cervical cancer progression. PMID: 28260085 this review shows that targeting the B7-H4 molecule may provide a promising potential for anticancer immunotherapy PMID: 27258187 Higher expression of HBx and B7-H4 was correlated with tumor progression of hepatitis B virus-hepatocellular carcinoma, suggesting that B7-H4 may be involved in facilitating HBV-related hepatocarcinogenesis. PMID: 27182163 Aberrant expression of B7-H4 has been identified to correlate with the TNM stage, differentiation degree and lymph node metastasis in patients with HCC. PMID: 27840912 B7-H4 may be overexpressed on the majority of cells in the IDC microenvironment, including macrophages. In vitro experiments revealed that M1 and M2 cells expressed B7-H4. Compared with M1 cells, M2 cells exhibited significantly higher expression levels of B7-H4. PMID: 27430170 wortmannin and rapamycin inhibit B7-H4-mediated tumor immunoresistance through regulating B7-H4 subcellular distribution. Taken together, these results suggest that PI3K/Akt/mTOR inhibitors might be used for adjuvant therapy aimed at inhibition of immune evasion. PMID: 28064317 Unstable cell surface antigens are not suitable as targets for ADCC, and we therefore performed an indirect ADCC-redirecting T-cell cytotoxicity assay to study B7-H4 using polyclonal anti-mouse IgG antibody-mediated linking. PMID: 27632942 Knockdown of B7-H4 increased CD8+ T cell-mediated cytotoxicity in vitro. PMID: 27177355 study provided the first evidence that B7-H4 facilitated esophageal squamous cell carcinoma cell proliferation through promoting IL-6/STAT3 positive loopback pathway activation PMID: 27088889 B7H4 antigen is a negative prognostic marker for pancreatic cancer patients and also seems to express resistance of pancreatic cancer patients to chemotherapy with gemcitabine. PMID: 25924930 B7-H3 and B7-H4 are involved in esophageal squamous cell carcinoma (ESCC) progression and development and their coexpression could be valuable prognostic indicators. PMID: 26411671 study suggest that serum B7-H4 is an independent prognostic indicator for HCC and may be a promising biomarker for early diagnosis as well as disease prognosis of HCC. PMID: 26505457 Data show that disrupted control of costimulation, evidenced by VTCN1 loss in both APCs and pancreatic islets, ultimately results in altered balance of control of immune responses. PMID: 26773144 Studied VTCN1 gene polymorphisms in susceptibility to Breast Cancer. PMID: 25385143 Data indicate that the diagnostic efficiency of V-set domain containing T cell activation inhibitor 1 (sB7-H4) combined carcinoembryonic antigen (CEA) was superior to either sB7-H4 or CEA. PMID: 26301886 In human amniotic fluid stem cells, the negative co-stimulatory molecule B7H4 regulates low immunogenicity, which can provide a modest inflammatory reaction microenvironment for wound repair. PMID: 26101181 In women who underwent elective cesarian section, a significant increase in sB7-H4 serum levels occurred postpartal, while in women who experienced spontaneous onset of labor, there were no differences between prepartal and postpartal levels. PMID: 25907449

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.