Recombinant Human V-Set Domain-Containing T-Cell Activation Inhibitor 1 (B7H4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11147P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human V-Set Domain-Containing T-Cell Activation Inhibitor 1 (B7H4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-11147P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human V-Set Domain-Containing T-Cell Activation Inhibitor 1 (B7H4) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q7Z7D3 |
| Target Symbol | B7H4 |
| Synonyms | B7 family member, H4; B7 H4; B7 homolog 4; B7 superfamily member 1; B7 superfamily, member 1; B7-H4; B7h.5; B7h4; B7S1; B7x; BC032925; Immune costimulatory protein B7-H4; Immune costimulatory protein B7H4; MGC41287; PRO1291; Protein B7S1; RP11 229A19.4; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; V set domain-containing T cell activation inhibitor 1; V-set domain-containing T-cell activation inhibitor 1; VCTN1; Vtcn1; VTCN1_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA |
| Expression Range | 26-258aa |
| Protein Length | Partial |
| Mol. Weight | 29.6kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Protein Families | Immunoglobulin superfamily, BTN/MOG family |
| Database References | HGNC: 28873 OMIM: 608162 KEGG: hsa:79679 STRING: 9606.ENSP00000358470 UniGene: PMID: 28425229 |
