Recombinant Human V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05735P
Greater than 95% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ml can bind Anti-VSIG4 recombinant antibody , the EC 50 is 51.14-68.73 ng/mL.
Recombinant Human V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-05735P
Regular price
$40700
$407.00
Sale price$24000
$240.00Save $167
/
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human V-Set And Immunoglobulin Domain-Containing Protein 4 (VSIG4) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human VSIG4 at 2 μg/ mL can bind Anti-VSIG4 recombinant antibody , the EC50 is 51.14-68.73 ng/mL. |
| Uniprotkb | Q9Y279 |
| Target Symbol | VSIG4 |
| Synonyms | (Protein Z39Ig) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-10His |
| Target Protein Sequence | RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP |
| Expression Range | 20-283aa |
| Protein Length | Partial |
| Mol. Weight | 30.6 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Phagocytic receptor, strong negative regulator of T-cell proliferation and IL2 production. Potent inhibitor of the alternative complement pathway convertases. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Database References | HGNC: 17032 OMIM: 300353 KEGG: hsa:11326 STRING: 9606.ENSP00000363869 UniGene: PMID: 28498255 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
